Measured by its binding ability in a functional ELISA. Immobilized yuaB at 5 μg/mL can bind human HP_0175 with a linear range of 31.25-600.00 ng/mL.

HP-0175 Protein, Helicobacter pylori, Recombinant (GST) is expressed in E. coli expression system with N-GST tag. The predicted molecular weight is 58.8 kDa and the accession number is P56112.

Helicobacter pylori

E. coli

Rotamase HP_0175,Putative peptidyl-prolyl cis-trans isomerase HP_0175

KPAHNANNATHNTKKTTDSSAGVLATVDGRPITKSDFDMIKQRNPNFDFDKLKEKEKEALIDQAIRTALVENEAKTEKLDSTPEFKAMMEAVKKQALVEFWAKKQAEEVKKVQIPEKEMQDFYNANKDQLFVKQEAHARHILVKTEDEAKRIISEIDKQPKAKKEAKFIELANRDTIDPNSKNAQNGGDLGKFQKNQMAPDFSKAAFALTPGDYTKTPVKTEFGYHIIYLISKDSPVTYTYEQAKPTIKGMLQEKLFQERMNQRIEELRKHAKIVINK

22-299 aa

> 90% as determined by SDS-PAGE.

A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.

Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.

N/A