Hyaluronidase Protein, Vespa magnifica, Recombinant (His)

Catalog No. TMPH-03700

Hydrolyzes high molecular weight hyaluronic acid to produce small oligosaccharides. Hyaluronidase Protein, Vespa magnifica, Recombinant (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 45.1 kDa and the accession number is P86875.

Hyaluronidase Protein, Vespa magnifica, Recombinant (His)

Catalog No. TMPH-03700

Pack Size	Price	Availability
20 μg	$360	20 days
100 μg	$678	20 days
1 mg	$2,300	20 days

Bulk & Custom

Add to Cart

Questions

Resource Download

User Guide of Recombinant Proteins

All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.

Product Information

Biological Activity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	Hydrolyzes high molecular weight hyaluronic acid to produce small oligosaccharides. Hyaluronidase Protein, Vespa magnifica, Recombinant (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 45.1 kDa and the accession number is P86875.
Species	Vespa magnifica
Expression System	E. coli
Tag	N-6xHis
Accession Number	P86875
Synonyms	Hyaluronoglucosaminidase,Hyaluronidase
Amino Acid	SERPKRVFNIYWNVPTFMCHQYGLYFDEVTNFNIKHNSKDNFQGDKIAIFYDPGEFPALLPLNYGKYKIRNGGVPQEGNITIHLQRFIEYLDKTYPNRNFSGIGVIDFERWRPIFRQNWGNMKIYKNFSIDLVRKEHPFWNKKMIELEASKRFEKYARLFMEETLKLAKKTRKQADWGYYGYPYCFNMSPTNFVPDCDVTARDENNEMSWLFNNQNVLLPSVYIRRELTPDQRIGLVQGRVKEAVRISNKLKHSPKVFSYWWYVYQDETNTFLTETDVKKTFQEIVINGGDGIIIWGSSSDVNSLSKCTRLREYLLTVLGPIAVNVTEAVN
Construction	27-357 aa
Protein Purity	> 85% as determined by SDS-PAGE.
Molecular Weight	45.1 kDa (predicted)
Formulation	Tris-based buffer, 50% glycerol
Reconstitution	A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
Shipping	In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.
Research Background	Hydrolyzes high molecular weight hyaluronic acid to produce small oligosaccharides.

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

Reconstitution Calculator
Recombinant Protein Dilution Calculator
Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.