Shopping Cart
  • Remove All
  • TargetMol
    Your shopping cart is currently empty

Influenza A H3N2 (strain A/X-31) Polymerase acidic Protein (His)

Catalog No. TMPH-02357

Influenza A H3N2 (strain A/X-31) Polymerase acidic Protein (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 18.6 kDa and the accession number is Q9IQ47.

Influenza A H3N2 (strain A/X-31) Polymerase acidic Protein (His)

Influenza A H3N2 (strain A/X-31) Polymerase acidic Protein (His)

Catalog No. TMPH-02357
Influenza A H3N2 (strain A/X-31) Polymerase acidic Protein (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 18.6 kDa and the accession number is Q9IQ47.
Pack SizePriceAvailabilityQuantity
20 μg$36020 days
100 μg$67820 days
1 mg$2,30020 days
Bulk & Custom
Add to Cart
Questions
View More
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
Influenza A H3N2 (strain A/X-31) Polymerase acidic Protein (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 18.6 kDa and the accession number is Q9IQ47.
Species
H3N2
Expression System
E. coli
TagN-6xHis
Accession NumberQ9IQ47
Synonyms
RNA-directed RNA polymerase subunit P2,Polymerase acidic protein,PA
Amino Acid
RREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQEMASRGLWDSFRQSERGEETIEERFEITGTMRKLADQSLPPNFSSLENFRAYVDGFEPNGYIEGKLS
Construction
124-247 aa
Protein Purity
> 90% as determined by SDS-PAGE.
Molecular Weight18.6 kDa (predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationTris-based buffer, 50% glycerol
Reconstitution
A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.
Research Background
Plays an essential role in viral RNA transcription and replication by forming the heterotrimeric polymerase complex together with PB1 and PB2 subunits. The complex transcribes viral mRNAs by using a unique mechanism called cap-snatching. It consists in the hijacking and cleavage of host capped pre-mRNAs. These short capped RNAs are then used as primers for viral mRNAs. The PB2 subunit is responsible for the binding of the 5' cap of cellular pre-mRNAs which are subsequently cleaved after 10-13 nucleotides by the PA subunit that carries the endonuclease activity.

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.