MPT51 Protein, Mycobacterium tuberculosis, Recombinant (His & SUMO)

Catalog No. TMPH-03019

May have a role in host tissue attachment, whereby ligands may include the serum protein fibronectin and small sugars. MPT51 Protein, Mycobacterium tuberculosis, Recombinant (His & SUMO) is expressed in E. coli expression system with N-6xHis-SUMO tag. The predicted molecular weight is 44.5 kDa and the accession number is P9WQN6.

MPT51 Protein, Mycobacterium tuberculosis, Recombinant (His & SUMO)

Catalog No. TMPH-03019

Pack Size	Price	Availability
20 μg	$360	20 days
100 μg	$678	20 days
1 mg	$2,300	20 days

Bulk & Custom

Add to Cart

Questions

Resource Download

User Guide of Recombinant Proteins

All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.

Product Information

Biological Activity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	May have a role in host tissue attachment, whereby ligands may include the serum protein fibronectin and small sugars. MPT51 Protein, Mycobacterium tuberculosis, Recombinant (His & SUMO) is expressed in E. coli expression system with N-6xHis-SUMO tag. The predicted molecular weight is 44.5 kDa and the accession number is P9WQN6.
Species	Mycobacterium tuberculosis
Expression System	E. coli
Tag	N-6xHis-SUMO
Accession Number	P9WQN6
Synonyms	MPT51/MPB51 antigen,mpt51
Amino Acid	AEPTAKAAPYENLMVPSPSMGRDIPVAFLAGGPHAVYLLDAFNAGPDVSNWVTAGNAMNTLAGKGISVVAPAGGAYSMYTNWEQDGSKQWDTFLSAELPDWLAANRGLAPGGHAAVGAAQGGYGAMALAAFHPDRFGFAGSMSGFLYPSNTTTNGAIAAGMQQFGGVDTNGMWGAPQLGRWKWHDPWVHASLLAQNNTRVWVWSPTNPGASDPAAMIGQAAEAMGNSRMFYNQYRSVGGHNGHFDFPASGDNGWGSWAPQLGAMSGDIVGAIR
Construction	27-299 aa
Protein Purity	> 90% as determined by SDS-PAGE.
Molecular Weight	44.5 kDa (predicted)
Formulation	Tris-based buffer, 50% glycerol
Reconstitution	A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
Shipping	In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.
Research Background	May have a role in host tissue attachment, whereby ligands may include the serum protein fibronectin and small sugars.

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

Reconstitution Calculator
Recombinant Protein Dilution Calculator
Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.