Shopping Cart
- Remove All
- Your shopping cart is currently empty
Involved in iron-sulfur cluster biogenesis. Binds a 4Fe-4S cluster, can transfer this cluster to apoproteins, and thereby intervenes in the maturation of Fe/S proteins. Could also act as a scaffold/chaperone for damaged Fe/S proteins. NfuA Protein, E. coli, Recombinant (Avi & His & MBP), Biotinylated is expressed in E. coli expression system with N-MBP and C-6xHis-Avi tag. The predicted molecular weight is 68.8 kDa and the accession number is B1X760.
Pack Size | Price | Availability | Quantity |
---|---|---|---|
20 μg | $547 | 20 days | |
100 μg | $948 | 20 days | |
1 mg | $2,720 | 20 days |
Biological Activity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first. |
Description | Involved in iron-sulfur cluster biogenesis. Binds a 4Fe-4S cluster, can transfer this cluster to apoproteins, and thereby intervenes in the maturation of Fe/S proteins. Could also act as a scaffold/chaperone for damaged Fe/S proteins. NfuA Protein, E. coli, Recombinant (Avi & His & MBP), Biotinylated is expressed in E. coli expression system with N-MBP and C-6xHis-Avi tag. The predicted molecular weight is 68.8 kDa and the accession number is B1X760. |
Species | ENT-Escherichia coli |
Expression System | E. coli |
Tag | N-MBP, C-6xHis-Avi |
Accession Number | B1X760 |
Synonyms | nfuA,Fe/S biogenesis protein NfuA |
Amino Acid | MIRISDAAQAHFAKLLANQEEGTQIRVFVINPGTPNAECGVSYCPPDAVEATDTALKFDLLTAYVDELSAPYLEDAEIDFVTDQLGSQLTLKAPNAKMRKVADDAPLMERVEYMLQSQINPQLAGHGGRVSLMEITEDGYAILQFGGGCNGCSMVDVTLKEGIEKQLLNEFPELKGVRDLTEHQRGEHSYY |
Construction | 1-191 aa |
Protein Purity | > 85% as determined by SDS-PAGE. |
Molecular Weight | 68.8 kDa (predicted) |
Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
Formulation | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
Shipping | In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice. |
Research Background | Involved in iron-sulfur cluster biogenesis. Binds a 4Fe-4S cluster, can transfer this cluster to apoproteins, and thereby intervenes in the maturation of Fe/S proteins. Could also act as a scaffold/chaperone for damaged Fe/S proteins. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.