Shopping Cart
- Remove All
Your shopping cart is currently empty
NfuA Protein, Vibrio vulnificus, Recombinant
Catalog No. TMPH-03705
Involved in iron-sulfur cluster biogenesis. Binds a 4Fe-4S cluster, can transfer this cluster to apoproteins, and thereby intervenes in the maturation of Fe/S proteins. Could also act as a scaffold/chaperone for damaged Fe/S proteins. NfuA Protein, Vibrio vulnificus, Recombinant is expressed in E. coli expression system. The predicted molecular weight is 21.0 kDa and the accession number is Q8DDU2.
NfuA Protein, Vibrio vulnificus, Recombinant
Catalog No. TMPH-03705
Involved in iron-sulfur cluster biogenesis. Binds a 4Fe-4S cluster, can transfer this cluster to apoproteins, and thereby intervenes in the maturation of Fe/S proteins. Could also act as a scaffold/chaperone for damaged Fe/S proteins. NfuA Protein, Vibrio vulnificus, Recombinant is expressed in E. coli expression system. The predicted molecular weight is 21.0 kDa and the accession number is Q8DDU2.
| Pack Size | Price | Availability | Quantity |
|---|---|---|---|
| 20 μg | $515 | 20 days | |
| 100 μg | $833 | 20 days | |
| 1 mg | $2,450 | 20 days |
Bulk & Custom
Add to Cart
Resource Download
Product Information
| Biological Activity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first. |
| Description | Involved in iron-sulfur cluster biogenesis. Binds a 4Fe-4S cluster, can transfer this cluster to apoproteins, and thereby intervenes in the maturation of Fe/S proteins. Could also act as a scaffold/chaperone for damaged Fe/S proteins. NfuA Protein, Vibrio vulnificus, Recombinant is expressed in E. coli expression system. The predicted molecular weight is 21.0 kDa and the accession number is Q8DDU2. |
| Species | Vibrio vulnificus |
| Expression System | E. coli |
| Tag | Tag Free |
| Accession Number | Q8DDU2 |
| Synonyms | nfuA,Fe/S biogenesis protein NfuA |
| Amino Acid | MSNITITEAAQTHFANLLGQQPDGTNIRVFVVNPGTQNAECGVSYCPPEAVEATDTEIPYQSFSAYVDELSLPFLEDAEIDYVTDKMGSQLTLKAPNAKMRKVADDAPLLERVEYAIQTQVNPQLAGHGGHVKLMEITDAGVAIVAFGGGCNGCSMVDVTLKEGIEKELLQQFSGELTAVRDATEHDRGDHSYY |
| Construction | 1-194 aa |
| Protein Purity | > 90% as determined by SDS-PAGE. |
| Molecular Weight | 21.0 kDa (predicted) |
| Formulation | Tris-based buffer, 50% glycerol |
| Reconstitution | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
| Shipping | In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice. |
| Research Background | Involved in iron-sulfur cluster biogenesis. Binds a 4Fe-4S cluster, can transfer this cluster to apoproteins, and thereby intervenes in the maturation of Fe/S proteins. Could also act as a scaffold/chaperone for damaged Fe/S proteins. |
Dose Conversion
You can also refer to dose conversion for different animals. More
Calculator
Tech Support
Please read the User Guide of Recombinant Proteins for more specific information.
Preview
- TOP
Feedback
Hello! How can I help you today? 
Copyright © 2015-2024 TargetMol Chemicals Inc. All Rights Reserved.