Shopping Cart
  • Remove All
  • TargetMol
    Your shopping cart is currently empty

Nicotinamidase/PNC1 Protein, S. cerevisiae, Recombinant

Catalog No. TMPH-03450

Catalyzes the deamidation of nicotinamide, an early step in the NAD(+) salvage pathway. Positively regulates SIR2-mediated silencing and longevity by preventing the accumulation of intracellular nicotinamide, an inhibitor of SIR2, during times of stress. Acts also on nicotinyl hydroxamate. Nicotinamidase/PNC1 Protein, S. cerevisiae, Recombinant is expressed in E. coli expression system. The predicted molecular weight is 25.0 kDa and the accession number is P53184.

Nicotinamidase/PNC1 Protein, S. cerevisiae, Recombinant

Nicotinamidase/PNC1 Protein, S. cerevisiae, Recombinant

Catalog No. TMPH-03450
Catalyzes the deamidation of nicotinamide, an early step in the NAD(+) salvage pathway. Positively regulates SIR2-mediated silencing and longevity by preventing the accumulation of intracellular nicotinamide, an inhibitor of SIR2, during times of stress. Acts also on nicotinyl hydroxamate. Nicotinamidase/PNC1 Protein, S. cerevisiae, Recombinant is expressed in E. coli expression system. The predicted molecular weight is 25.0 kDa and the accession number is P53184.
Pack SizePriceAvailabilityQuantity
20 μg $51520 days
100 μg $91620 days
1 mg $2,69020 days
Bulk & Custom
Add to Cart
Questions
View More
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
Catalyzes the deamidation of nicotinamide, an early step in the NAD(+) salvage pathway. Positively regulates SIR2-mediated silencing and longevity by preventing the accumulation of intracellular nicotinamide, an inhibitor of SIR2, during times of stress. Acts also on nicotinyl hydroxamate. Nicotinamidase/PNC1 Protein, S. cerevisiae, Recombinant is expressed in E. coli expression system. The predicted molecular weight is 25.0 kDa and the accession number is P53184.
Species
Saccharomyces cerevisiae
Expression System
E. coli
TagTag Free
Accession NumberP53184
Synonyms
PNC1,Nicotinamide deamidase,Nicotinamidase
Amino Acid
MKTLIVVDMQNDFISPLGSLTVPKGEELINPISDLMQDADRDWHRIVVTRDWHPSRHISFAKNHKDKEPYSTYTYHSPRPGDDSTQEGILWPVHCVKNTWGSQLVDQIMDQVVTKHIKIVDKGFLTDREYYSAFHDIWNFHKTDMNKYLEKHHTDEVYIVGVALEYCVKATAISAAELGYKTTVLLDYTRPISDDPEVINKVKEELKAHNINVVDK
Construction
1-216 aa
Protein Purity
> 90% as determined by SDS-PAGE.
Molecular Weight25.0 kDa (predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationTris-based buffer, 50% glycerol
Reconstitution
A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.
Research Background
Catalyzes the deamidation of nicotinamide, an early step in the NAD(+) salvage pathway. Positively regulates SIR2-mediated silencing and longevity by preventing the accumulation of intracellular nicotinamide, an inhibitor of SIR2, during times of stress. Acts also on nicotinyl hydroxamate.

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.