Shopping Cart
  • Remove All
  • TargetMol
    Your shopping cart is currently empty

Noggin/NOG Protein, Human, Recombinant (E. coli)

Catalog No. TMPH-04040

Noggin/NOG Protein, Human, Recombinant (E. coli) is expressed in E. coli with Tag Free. The accession number is Q13253.

Noggin/NOG Protein, Human, Recombinant (E. coli)

Noggin/NOG Protein, Human, Recombinant (E. coli)

Catalog No. TMPH-04040
Noggin/NOG Protein, Human, Recombinant (E. coli) is expressed in E. coli with Tag Free. The accession number is Q13253.
Pack SizePriceAvailabilityQuantity
5 μg $13020 days
100 μg $1,38020 days
500 μg $3,17020 days
Bulk & Custom
Add to Cart
Questions
View More
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.

Product Information

Biological Activity
Fully biologically active when compared to standard. The ED50 as determined by inhibiting BMP-4- induced alkaline phosphatase production of murine ATDC5 cells is less than 3.0 ng/ml, corresponding to a specific activity of > 3.3 × 105 IU/mg in the presence of 5 ng/ml rHuBMP-4.
Description
Noggin/NOG Protein, Human, Recombinant (E. coli) is expressed in E. coli with Tag Free. The accession number is Q13253.
Species
Human
Expression System
E. coli
TagTag Free
Accession NumberQ13253
Amino Acid
M+QHYLHIRPAPSDNLPLVDLIEHPDPIFDPKEKDLNETLLRSLLGGHYDPGFMATSPPEDRPGGGGGAAGGAEDLAELDQLLRQRPSGAMPSEIKGLEFSEGLAQGKKQRLSKKLRRKLQMWLWSQTFCPVLYAWNDLGSRFWPRYVKVGSCFSKRSCSVPEGMVCKPSKSVHLTVLRWRCQRRGGQRCGWIPIQYPIISECKCSC
Construction
M+28-232 aa
Protein Purity
>95% as determined by SDS-PAGE.
Molecular Weight23.2 kDa (Predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationLyophilized from a 0.2 μm filtered 30 % acetonitrile, 0.1 % TFA
Reconstitution
Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords