Shopping Cart
  • Remove All
  • TargetMol
    Your shopping cart is currently empty

Oncostatin M/OSM Protein, Rhesus macaque, Recombinant (His)

Catalog No. TMPH-02445

Oncostatin M/OSM Protein, Rhesus macaque, Recombinant (His) is expressed in Baculovirus insect cells with N-10xHis tag. The predicted molecular weight is 28.8 kDa and the accession number is F7GF43.

Oncostatin M/OSM Protein, Rhesus macaque, Recombinant (His)

Oncostatin M/OSM Protein, Rhesus macaque, Recombinant (His)

Catalog No. TMPH-02445
Oncostatin M/OSM Protein, Rhesus macaque, Recombinant (His) is expressed in Baculovirus insect cells with N-10xHis tag. The predicted molecular weight is 28.8 kDa and the accession number is F7GF43.
Pack SizePriceAvailabilityQuantity
20 μg$49120 days
100 μg$1,37020 days
1 mg$2,75020 days
Bulk & Custom
Add to Cart
Questions
View More
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
Oncostatin M/OSM Protein, Rhesus macaque, Recombinant (His) is expressed in Baculovirus insect cells with N-10xHis tag. The predicted molecular weight is 28.8 kDa and the accession number is F7GF43.
Species
Rhesus
Expression System
Baculovirus Insect Cells
TagN-10xHis
Accession NumberF7GF43
Synonyms
OSM
Amino Acid
MASMAAMGSCSKEYRMLLGQLQKQTDLMQDTSRLLDPYIRIQGLDIPKLREHCRESPGAFPSEETLRGLGRRGFLQTLNATLGRVLHRLADLEQHLPKAQDLERSGLNIEDLEKLQMARPNVLGLRNNVYCMAQLLDNSDMTEPTKAGRGTPQPPTPTPTSDVFQRKLEGCSFLRGYHRFMHSVGRVFSKWGESPNRSRRHSPHQALRKGVRRTRPSRKGNRLMPRGQLPR
Construction
1-231 aa
Protein Purity
> 85% as determined by SDS-PAGE.
Molecular Weight28.8 kDa (predicted)
FormulationTris-based buffer, 50% glycerol
Reconstitution
A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.