Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.

Part of the Tol-Pal system, which plays a role in outer membrane invagination during cell division and is important for maintaining outer membrane integrity. Very strongly associated with the peptidoglycan.

Legionella pneumophila

E. coli

PPL,Peptidoglycan-associated lipoprotein,pal,19 kDa surface antigen

CSKTPGSADGGAAVGDGDATAQGLGQMTHFAGQEPGESYTTQAPHNQLYLFAYDDSTLASKYLPSVNAQAEYLKTHPGARVMIAGHTDERGSREYNVALGERRADTVAEILRMAGVSRQQIRVVSYGKERPANYGHDEASHAQNRRVEFIYEATR

22-176 aa

> 90% as determined by SDS-PAGE.

A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.

Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.

Part of the Tol-Pal system, which plays a role in outer membrane invagination during cell division and is important for maintaining outer membrane integrity. Very strongly associated with the peptidoglycan.