Shopping Cart
- Remove All
- Your shopping cart is currently empty
Peroxiredoxin 6 Protein, Mouse, Recombinant (His) is expressed in E. coli with C-6xHis. The accession number is O08709.
Pack Size | Price | Availability | Quantity |
---|---|---|---|
20 μg | $283 | 20 days | |
100 μg | $537 | 20 days | |
1 mg | $2,300 | 20 days |
Biological Activity | Activity testing is in progress. It is theoretically active, but we cannot guarantee it. |
Description | Peroxiredoxin 6 Protein, Mouse, Recombinant (His) is expressed in E. coli with C-6xHis. The accession number is O08709. |
Species | Mouse |
Expression System | E. coli |
Tag | C-6xHis |
Accession Number | O08709 |
Synonyms | Prdx6,Prdx5,Peroxiredoxin-6,Non-selenium glutathione peroxidase (NSGPx),Lysophosphatidylcholine acyltransferase 5 (LPC acyltransferase 5;LPCAT-5;Lyso-PC acyltransferase 5),Ltw4,Glutathione-dependent peroxiredoxin,Aop2,Antioxidant protein 2,Acidic calcium-independent phospholipase A2 (aiPLA2),1-Cys peroxiredoxin (1-Cys PRX) |
Amino Acid | PGGLLLGDEAPNFEANTTIGRIRFHDFLGDSWGILFSHPRDFTPVCTTELGRAAKLAPEFAKRNVKLIALSIDSVEDHLAWSKDINAYNGETPTEKLPFPIIDDKGRDLAILLGMLDPVEKDDNNMPVTARVVFIFGPDKKLKLSILYPATTGRNFDEILRVVDSLQLTGTKPVATPVDWKKGESVMVVPTLSEEEAKQCFPKGVFTKELPSGKKYLRYTPQP |
Construction | 2-224 aa |
Protein Purity | >95% as determined by SDS-PAGE. |
Molecular Weight | 31.7 kDa (Predicted) |
Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
Formulation | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
Shipping | In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.