Shopping Cart
- Remove All
![TargetMol](https://newstatic.targetmol.com/error/oops.webp)
Your shopping cart is currently empty
Pack Size | Price | Availability | Quantity |
---|---|---|---|
20 μg | $1,690 | 20 days | |
100 μg | $2,950 | 20 days |
Description | Might be involved in growth regulation, and in myelinization in the peripheral nervous system. Pmp22 Protein, Rat, Recombinant (His) is expressed in E. coli expression system with N-10xHis tag. The predicted molecular weight is 23.4 kDa and the accession number is P25094. |
Species | Rat |
Expression System | E. coli |
Tag | N-10xHis |
Accession Number | P25094 |
Synonyms | Peripheral myelin protein 22,Schwann cell membrane glycoprotein,Pmp22,SR13 myelin protein,Protein CD25 |
Amino Acid | MLLLLLGILFLHIAVLVLLFVSTIVSQWLVGNGHRTDLWQNCTTSALGAVQHCYSSSVSEWLQSVQATMILSVIFSVLSLFLFFCQLFTLTKGGRFYITGVFQILAGLCVMSAAAIYTVRHSEWHVNNDYSYGFAYILAWVAFPLALLSGIIYVILRKRE |
Construction | 1-160 aa |
Protein Purity | > 85% as determined by SDS-PAGE. |
Molecular Weight | 23.4 kDa (predicted) |
Formulation | Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
Shipping | In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice. |
Research Background | Might be involved in growth regulation, and in myelinization in the peripheral nervous system. |
Copyright © 2015-2024 TargetMol Chemicals Inc. All Rights Reserved.