Shopping Cart
  • Remove All
  • TargetMol
    Your shopping cart is currently empty

S100A9 Protein, Bovine, Recombinant (His & Myc & SUMO)

Catalog No. TMPH-00297

S100A9 Protein, Bovine, Recombinant (His & Myc & SUMO) is expressed in E. coli expression system with N-6xHis-SUMO and C-Myc tag. The predicted molecular weight is 34.5 kDa and the accession number is P28783.

S100A9 Protein, Bovine, Recombinant (His & Myc & SUMO)

S100A9 Protein, Bovine, Recombinant (His & Myc & SUMO)

Catalog No. TMPH-00297
S100A9 Protein, Bovine, Recombinant (His & Myc & SUMO) is expressed in E. coli expression system with N-6xHis-SUMO and C-Myc tag. The predicted molecular weight is 34.5 kDa and the accession number is P28783.
Pack SizePriceAvailabilityQuantity
20 μg$19820 days
100 μg$38920 days
1 mg$1,68020 days
Bulk & Custom
Add to Cart
Questions
View More
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
S100A9 Protein, Bovine, Recombinant (His & Myc & SUMO) is expressed in E. coli expression system with N-6xHis-SUMO and C-Myc tag. The predicted molecular weight is 34.5 kDa and the accession number is P28783.
Species
Bovine
Expression System
E. coli
TagN-6xHis-SUMO, C-Myc
Accession NumberP28783
Synonyms
S100A9,S100 calcium-binding protein A9,Protein S100-A9,Neutrophil cytosolic 23 kDa protein,Calgranulin-B,BEE22
Amino Acid
EDKMSQMESSIETIINIFHQYSVRLGHYDTLIQKEFKQLVQKELPNFLKKQKKNEAAINEIMEDLDTNVDKQLSFEEFIMLVARLTVASHEEMHNTAPPGQGHRHGPGYGKGGSGSCSGQGSPDQGSHDLGSHGHGHGHSHGGHGHSHGGHGHSH
Construction
2-156 aa
Protein Purity
> 85% as determined by SDS-PAGE.
Molecular Weight34.5 kDa (predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationTris-based buffer, 50% glycerol
Reconstitution
A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.
Research Background
S100A9 is a calcium- and zinc-binding protein which plays a prominent role in the regulation of inflammatory processes and immune response. It can induce neutrophil chemotaxis, adhesion, can increase the bactericidal activity of neutrophils by promoting phagocytosis via activation of SYK, PI3K/AKT, and ERK1/2 and can induce degranulation of neutrophils by a MAPK-dependent mechanism. Predominantly found as calprotectin (S100A8/A9) which has a wide plethora of intra- and extracellular functions. The intracellular functions include: facilitating leukocyte arachidonic acid trafficking and metabolism, modulation of the tubulin-dependent cytoskeleton during migration of phagocytes and activation of the neutrophilic NADPH-oxidase. Activates NADPH-oxidase by facilitating the enzyme complex assembly at the cell membrane, transferring arachidonic acid, an essential cofactor, to the enzyme complex and S100A8 contributes to the enzyme assembly by directly binding to NCF2/P67PHOX. The extracellular functions involve proinflammatory, antimicrobial, oxidant-scavenging and apoptosis-inducing activities. Its proinflammatory activity includes recruitment of leukocytes, promotion of cytokine and chemokine production, and regulation of leukocyte adhesion and migration. Acts as an alarmin or a danger associated molecular pattern (DAMP) molecule and stimulates innate immune cells via binding to pattern recognition receptors such as Toll-like receptor 4 (TLR4) and receptor for advanced glycation endproducts (AGER). Binding to TLR4 and AGER activates the MAP-kinase and NF-kappa-B signaling pathways resulting in the amplification of the proinflammatory cascade. Has antimicrobial activity towards bacteria and fungi and exerts its antimicrobial activity probably via chelation of Zn(2+) which is essential for microbial growth. Can induce cell death via autophagy and apoptosis and this occurs through the cross-talk of mitochondria and lysosomes via reactive oxygen species (ROS) and the process involves BNIP3. Can regulate neutrophil number and apoptosis by an anti-apoptotic effect; regulates cell survival via ITGAM/ITGB and TLR4 and a signaling mechanism involving MEK-ERK. Its role as an oxidant scavenger has a protective role in preventing exaggerated tissue damage by scavenging oxidants. The iNOS-S100A8/A9 transnitrosylase complex is proposed to direct selective inflammatory stimulus-dependent S-nitrosylation of multiple targets such as GAPDH, NXA5, EZR, MSN and VIM by recognizing a [IL]-x-C-x-x-[DE] motif.

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.