Shopping Cart
  • Remove All
  • TargetMol
    Your shopping cart is currently empty

SplB Protein, S. aureus, Recombinant (His & Myc)

Catalog No. TMPH-03572

Serine protease that cleaves specifically after the sequence Trp-Glu-Leu-Gln. SplB Protein, S. aureus, Recombinant (His & Myc) is expressed in E. coli expression system with N-10xHis and C-Myc tag. The predicted molecular weight is 29.8 kDa and the accession number is A7X3Q8.

SplB Protein, S. aureus, Recombinant (His & Myc)

SplB Protein, S. aureus, Recombinant (His & Myc)

Catalog No. TMPH-03572
Serine protease that cleaves specifically after the sequence Trp-Glu-Leu-Gln. SplB Protein, S. aureus, Recombinant (His & Myc) is expressed in E. coli expression system with N-10xHis and C-Myc tag. The predicted molecular weight is 29.8 kDa and the accession number is A7X3Q8.
Pack SizePriceAvailabilityQuantity
20 μg$36020 days
100 μg$67820 days
1 mg$2,30020 days
Bulk & Custom
Add to Cart
Questions
View More
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
Serine protease that cleaves specifically after the sequence Trp-Glu-Leu-Gln. SplB Protein, S. aureus, Recombinant (His & Myc) is expressed in E. coli expression system with N-10xHis and C-Myc tag. The predicted molecular weight is 29.8 kDa and the accession number is A7X3Q8.
Species
Staphylococcus aureus
Expression System
E. coli
TagN-10xHis, C-Myc
Accession NumberA7X3Q8
Synonyms
splB,Serine protease SplB
Amino Acid
ENNVTKIQDTNIFPYTGVVAFKSATGFVVGKNTILTNKHVSKNYKVGDRITAHPNSDKGNGGIYSIKKIINYPGKEDVSVIQVEERAIERGPKGFNFNDNVTPFKYAAGAKAGERIKVIGYPHPYKNKYVLYESTGPVMSVEGSSIVYSAHTESGNSGSPVLNSNNELVGIHFASDVKNDDNRNAYGVYFTPEIKKFIAENIDK
Construction
37-240 aa
Protein Purity
> 90% as determined by SDS-PAGE.
Molecular Weight29.8 kDa (predicted)
FormulationIf the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.
Research Background
Serine protease that cleaves specifically after the sequence Trp-Glu-Leu-Gln.

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.