tRNA (guanine-N(7)-)-methyltransferase Protein, Brugia malayi, Recombinant (His)

Catalog No. TMPH-00313

Catalyzes the formation of N(7)-methylguanine at position 46 (m7G46) in tRNA. tRNA (guanine-N(7)-)-methyltransferase Protein, Brugia malayi, Recombinant (His) is expressed in E. coli expression system with N-10xHis tag. The predicted molecular weight is 36.3 kDa and the accession number is A8NFF0.

tRNA (guanine-N(7)-)-methyltransferase Protein, Brugia malayi, Recombinant (His)

Catalog No. TMPH-00313

Pack Size	Price	Availability
20 μg	$360	20 days
100 μg	$678	20 days
1 mg	$2,300	20 days

Bulk & Custom

Add to Cart

Questions

Resource Download

User Guide of Recombinant Proteins

All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.

Product Information

Biological Activity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	Catalyzes the formation of N(7)-methylguanine at position 46 (m7G46) in tRNA. tRNA (guanine-N(7)-)-methyltransferase Protein, Brugia malayi, Recombinant (His) is expressed in E. coli expression system with N-10xHis tag. The predicted molecular weight is 36.3 kDa and the accession number is A8NFF0.
Species	Brugia malayi
Expression System	E. coli
Tag	N-10xHis
Accession Number	A8NFF0
Synonyms	tRNA(m7G46)-methyltransferase,tRNA (guanine-N(7)-)-methyltransferase,tRNA (guanine(46)-N(7))-methyltransferase
Amino Acid	MVSTENKIGLFKNKDDDIDGEEMRELPQKKFYRQRAHANPISDHEFDYPVFPEQMDWKKYFGDFSEGRQVEFADVGCGYGGLLIKLSTLYPEALMVGLEIRVKVSDYVQDKIHALRLREPGNYRNVACLRTNAMKYLPNYFRRHQLTKMFFLYPDPHFKKAKHKWRIITPTLLAEYAYVLKPGGLVYTITDVEELHIWMVRHLSAHPLFERLTDLEMKMDPVVEMLYDSTEEGQKVARNEGSKWSAVFRRLPNPVLSS
Construction	1-258 aa
Protein Purity	> 85% as determined by SDS-PAGE.
Molecular Weight	36.3 kDa (predicted)
Formulation	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
Shipping	In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.
Research Background	Catalyzes the formation of N(7)-methylguanine at position 46 (m7G46) in tRNA.

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

Reconstitution Calculator
Recombinant Protein Dilution Calculator
Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.