Shopping Cart
  • Remove All
  • TargetMol
    Your shopping cart is currently empty

Vaccinia virus (strain Western Reserve) K3 Protein (His)

Catalog No. TMPH-03671

Viral mimic of eIF-2-alpha that acts as a pseudosubstrate for EIF2AK2/PKR kinase. Inhibits therefore eIF-2-alpha phosphorylation by host EIF2AK2/PKR kinase and prevents protein synthesis shutoff. Vaccinia virus (strain Western Reserve) K3 Protein (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 12.6 kDa and the accession number is P18378.

Vaccinia virus (strain Western Reserve) K3 Protein (His)

Vaccinia virus (strain Western Reserve) K3 Protein (His)

Catalog No. TMPH-03671
Viral mimic of eIF-2-alpha that acts as a pseudosubstrate for EIF2AK2/PKR kinase. Inhibits therefore eIF-2-alpha phosphorylation by host EIF2AK2/PKR kinase and prevents protein synthesis shutoff. Vaccinia virus (strain Western Reserve) K3 Protein (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 12.6 kDa and the accession number is P18378.
Pack SizePriceAvailabilityQuantity
20 μg $39720 days
100 μg $84520 days
500 μg $1,95020 days
Bulk & Custom
Add to Cart
Questions
View More
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
Viral mimic of eIF-2-alpha that acts as a pseudosubstrate for EIF2AK2/PKR kinase. Inhibits therefore eIF-2-alpha phosphorylation by host EIF2AK2/PKR kinase and prevents protein synthesis shutoff. Vaccinia virus (strain Western Reserve) K3 Protein (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 12.6 kDa and the accession number is P18378.
Species
VACV
Expression System
P. pastoris (Yeast)
TagN-6xHis
Accession NumberP18378
Synonyms
Protein K3,Protein K2
Amino Acid
MLAFCYSLPNAGDVIKGRVYEKDYALYIYLFDYPHFEAILAESVKMHMDRYVEYRDKLVGKTVKVKVIRVDYTKGYIDVNYKRMCRHQ
Construction
1-88 aa
Protein Purity
> 90% as determined by SDS-PAGE.
Molecular Weight12.6 kDa (predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationTris-based buffer, 50% glycerol
Reconstitution
A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.
Research Background
Viral mimic of eIF-2-alpha that acts as a pseudosubstrate for EIF2AK2/PKR kinase. Inhibits therefore eIF-2-alpha phosphorylation by host EIF2AK2/PKR kinase and prevents protein synthesis shutoff.

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.