Shopping Cart
  • Remove All
  • TargetMol
    Your shopping cart is currently empty

Vaccinia virus (strain Western Reserve) L1 Protein (His)

Catalog No. TMPH-03676

Envelope protein which probably plays a role in virus entry into the host cell. Is probably involved in the virus attachment to the host cell surface and associates with the entry/fusion complex (EFC). Needed for fusion and penetration of the virus core into host cell. Vaccinia virus (strain Western Reserve) L1 Protein (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 21.3 kDa and the accession number is P07612.

Vaccinia virus (strain Western Reserve) L1 Protein (His)

Vaccinia virus (strain Western Reserve) L1 Protein (His)

Catalog No. TMPH-03676
Envelope protein which probably plays a role in virus entry into the host cell. Is probably involved in the virus attachment to the host cell surface and associates with the entry/fusion complex (EFC). Needed for fusion and penetration of the virus core into host cell. Vaccinia virus (strain Western Reserve) L1 Protein (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 21.3 kDa and the accession number is P07612.
Pack SizePriceAvailabilityQuantity
20 μg $39720 days
100 μg $84520 days
1 mg $2,97020 days
Bulk & Custom
Add to Cart
Questions
View More
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
Envelope protein which probably plays a role in virus entry into the host cell. Is probably involved in the virus attachment to the host cell surface and associates with the entry/fusion complex (EFC). Needed for fusion and penetration of the virus core into host cell. Vaccinia virus (strain Western Reserve) L1 Protein (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 21.3 kDa and the accession number is P07612.
Species
VACV
Expression System
P. pastoris (Yeast)
TagN-6xHis
Accession NumberP07612
Synonyms
Virion membrane protein M25,Protein L1,OPG099,Entry-fusion complex associated protein OPG095,EFC-associated protein OPG095
Amino Acid
GAAASIQTTVNTLSERISSKLEQEANASAQTKCDIEIGNFYIRQNHGCNLTVKNMCSADADAQLDAVLSAATETYSGLTPEQKAYVPAMFTAALNIQTSVNTVVRDFENYVKQTCNSSAVVDNKLKIQNVIIDECYGAPGSPTNLEFINTGSSKGNCAIKALMQLTTKATTQIAPKQVAGTG
Construction
2-183 aa
Protein Purity
> 85% as determined by SDS-PAGE.
Molecular Weight21.3 kDa (predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationTris-based buffer, 50% glycerol
Reconstitution
A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.
Research Background
Envelope protein which probably plays a role in virus entry into the host cell. Is probably involved in the virus attachment to the host cell surface and associates with the entry/fusion complex (EFC). Needed for fusion and penetration of the virus core into host cell.

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.