Shopping Cart
  • Remove All
  • TargetMol
    Your shopping cart is currently empty

Variola virus (isolate Human/India/Ind3/1967) OPG154 Protein (His)

Catalog No. TMPH-03686

Structural protein involved in the envelopment of mature virion (MV) to form the wrapped virion (WV). The wrapping consists of the addition of Golgi membranes to the mature virion. Participates in mature virion (MV) movement within the infected cell. May play an indirect role in MV-cell fusion. Variola virus (isolate Human/India/Ind3/1967) OPG154 Protein (His) is expressed in HEK293 mammalian cells with N-6xHis tag. The predicted molecular weight is 16.5 kDa and the accession number is P33816.

Variola virus (isolate Human/India/Ind3/1967) OPG154 Protein (His)

Variola virus (isolate Human/India/Ind3/1967) OPG154 Protein (His)

Catalog No. TMPH-03686
Structural protein involved in the envelopment of mature virion (MV) to form the wrapped virion (WV). The wrapping consists of the addition of Golgi membranes to the mature virion. Participates in mature virion (MV) movement within the infected cell. May play an indirect role in MV-cell fusion. Variola virus (isolate Human/India/Ind3/1967) OPG154 Protein (His) is expressed in HEK293 mammalian cells with N-6xHis tag. The predicted molecular weight is 16.5 kDa and the accession number is P33816.
Pack SizePriceAvailabilityQuantity
20 μg$46520 days
100 μg$1,30020 days
500 μg$3,91020 days
Bulk & Custom
Add to Cart
Questions
View More
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
Structural protein involved in the envelopment of mature virion (MV) to form the wrapped virion (WV). The wrapping consists of the addition of Golgi membranes to the mature virion. Participates in mature virion (MV) movement within the infected cell. May play an indirect role in MV-cell fusion. Variola virus (isolate Human/India/Ind3/1967) OPG154 Protein (His) is expressed in HEK293 mammalian cells with N-6xHis tag. The predicted molecular weight is 16.5 kDa and the accession number is P33816.
Species
VARV
Expression System
HEK293 Cells
TagN-6xHis
Accession NumberP33816
Synonyms
Protein OPG154,OPG154
Amino Acid
MDGTLFPGDDDLAIPATEFFSTKAAKKPEAKREAIVKADGDNNEETLKQRLTNLEKKITNVTTKFEQIEKCCKRNDDVLFRLENHAETLRAAMISLAKKIDVQTGRRPYE
Construction
1-110 aa
Protein Purity
> 90% as determined by SDS-PAGE.
Molecular Weight16.5 kDa (predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationTris-based buffer, 50% glycerol
Reconstitution
A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.
Research Background
Structural protein involved in the envelopment of mature virion (MV) to form the wrapped virion (WV). The wrapping consists of the addition of Golgi membranes to the mature virion. Participates in mature virion (MV) movement within the infected cell. May play an indirect role in MV-cell fusion.

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.