Shopping Cart
- Remove All
![TargetMol](https://newstatic.targetmol.com/error/oops.webp)
Your shopping cart is currently empty
Pack Size | Price | Availability | Quantity |
---|---|---|---|
5 mg | Inquiry | Backorder | |
50 mg | Inquiry | Backorder |
Description | STIEEQAKTFLDKFNHEAEDLFYQSSLASWN, a peptide related to angiotensin-converting enzyme 2 (ACE2), is utilized in research to examine ACE2's function [1]. |
Molecular Weight | 3649.88 |
Formula | C164H238N40O55 |
Cas No. |
Storage | keep away from moisture Powder: -20°C for 3 years | In solvent: -80°C for 1 year |
Copyright © 2015-2024 TargetMol Chemicals Inc. All Rights Reserved.