Shopping Cart
  • Remove All
  • TargetMol
    Your shopping cart is currently empty

CXCL10 Protein, Human, Recombinant (His)

Catalog No. TMPH-03770

CXCL10 Protein, Human, Recombinant (His) is expressed in E. coli expression system. The predicted molecular weight is 12.6 kDa and the accession number is P02778.

CXCL10 Protein, Human, Recombinant (His)

CXCL10 Protein, Human, Recombinant (His)

Catalog No. TMPH-03770
CXCL10 Protein, Human, Recombinant (His) is expressed in E. coli expression system. The predicted molecular weight is 12.6 kDa and the accession number is P02778.
Pack SizePriceAvailabilityQuantity
20 μg $20820 days
100 μg $42920 days
1 mg $1,85020 days
Bulk & Custom
Add to Cart
Questions
View More
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
CXCL10 Protein, Human, Recombinant (His) is expressed in E. coli expression system. The predicted molecular weight is 12.6 kDa and the accession number is P02778.
Species
Human
Expression System
E. coli
TagN-6xHis
Accession NumberP02778
Amino Acid
VPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCLNPESKAIKNLLKAVSKERSKRSP
Construction
22-98 aa
Protein Purity
> 90% as determined by SDS-PAGE.
Molecular Weight12.6 kDa as predicted
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationTris-based buffer,50% glycerol
Reconstitution
A hardcopy of COA with reconstitution instructions is sent along with the products. Please refer to it for detailed information.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.
Research Background
Pro-inflammatory cytokine that is involved in a wide variety of processes such as chemotaxis, differentiation, and activation of peripheral immune cells, regulation of cell growth, apoptosis and modulation of angiostatic effects. Plays thereby an important role during viral infections by stimulating the activation and migration of immune cells to the infected sites. Mechanistically, binding of CXCL10 to the CXCR3 receptor activates G protein-mediated signaling and results in downstream activation of phospholipase C-dependent pathway, an increase in intracellular calcium production and actin reorganization. In turn, recruitment of activated Th1 lymphocytes occurs at sites of inflammation. Activation of the CXCL10/CXCR3 axis plays also an important role in neurons in response to brain injury for activating microglia, the resident macrophage population of the central nervous system, and directing them to the lesion site. This recruitment is an essential element for neuronal reorganization.

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords