OX40L/TNFSF4 Protein, Rabbit, Recombinant (hFc)

Catalog No. TMPH-03215

Cytokine that binds to TNFRSF4. Co-stimulates T-cell proliferation and cytokine production. TNFSF4 Protein, Rabbit, Recombinant (hFc) is expressed in HEK293 mammalian cells with C-hFc tag. The predicted molecular weight is 44.9 kDa and the accession number is O02765.

OX40L/TNFSF4 Protein, Rabbit, Recombinant (hFc)

Catalog No. TMPH-03215

Pack Size	Price	Availability
20 μg	583 €	20 days
100 μg	1.634 €	20 days
1 mg	6.878 €	20 days

Bulk & Custom

Add to Cart

Questions

Resource Download

User Guide of Recombinant Proteins

All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.

Product Information

Biological Activity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	Cytokine that binds to TNFRSF4. Co-stimulates T-cell proliferation and cytokine production. TNFSF4 Protein, Rabbit, Recombinant (hFc) is expressed in HEK293 mammalian cells with C-hFc tag. The predicted molecular weight is 44.9 kDa and the accession number is O02765.
Species	Rabbit
Expression System	HEK293 Cells
Tag	C-hFc
Accession Number	O02765
Synonyms	Tumor necrosis factor ligand superfamily member 4,TNFSF4,OX40 ligand
Amino Acid	QHSHAPEVSLQYPPIENIMTQLQILTSHECEEDSFILPLQKRDGTMEVQNNSVVIQCDGFYLLSLKGYFSQEVSISLHYRKGEEPFPILKKTKFANSNVVLKLGYKDKVYLNVTTDSASCKQLSVNAGELIVILQNPGGYCAP
Construction	45-187 aa
Protein Purity	> 90% as determined by SDS-PAGE.
Molecular Weight	44.9 kDa (predicted)
Formulation	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
Shipping	In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.
Research Background	Cytokine that binds to TNFRSF4. Co-stimulates T-cell proliferation and cytokine production.

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

Reconstitution Calculator
Recombinant Protein Dilution Calculator
Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.