Shopping Cart
- Remove All
![TargetMol](https://www.targetmol.com/storage/error/oops.webp)
Your shopping cart is currently empty
Pack Size | Price | Availability | Quantity |
---|---|---|---|
20 μg | $614 | 20 days | |
100 μg | $1,720 | 20 days | |
1 mg | $7,240 | 20 days |
Description | Cytokine that binds to TNFRSF4. Co-stimulates T-cell proliferation and cytokine production. TNFSF4 Protein, Rabbit, Recombinant (hFc) is expressed in HEK293 mammalian cells with C-hFc tag. The predicted molecular weight is 44.9 kDa and the accession number is O02765. |
Species | Rabbit |
Expression System | HEK293 Cells |
Tag | C-hFc |
Accession Number | O02765 |
Synonyms | TNFSF4,OX40 ligand,Tumor necrosis factor ligand superfamily member 4 |
Amino Acid | QHSHAPEVSLQYPPIENIMTQLQILTSHECEEDSFILPLQKRDGTMEVQNNSVVIQCDGFYLLSLKGYFSQEVSISLHYRKGEEPFPILKKTKFANSNVVLKLGYKDKVYLNVTTDSASCKQLSVNAGELIVILQNPGGYCAP |
Construction | 45-187 aa |
Protein Purity | > 90% as determined by SDS-PAGE. |
Molecular Weight | 44.9 kDa (predicted) |
Formulation | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
Shipping | In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice. |
Research Background | Cytokine that binds to TNFRSF4. Co-stimulates T-cell proliferation and cytokine production. |
Copyright © 2015-2024 TargetMol Chemicals Inc. All Rights Reserved.