Shopping Cart
- Remove All
- Your shopping cart is currently empty
IL-4 Protein, Mesocricetus auratus, Recombinant (His) is expressed in yeast with C-6xHis tag. The predicted molecular weight is 16.3 kDa and the accession number is Q60440.
Pack Size | Price | Availability | Quantity |
---|---|---|---|
20 μg | $256 | 20 days | |
100 μg | $528 | 20 days | |
500 μg | $1,460 | 20 days |
Biological Activity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first. |
Description | IL-4 Protein, Mesocricetus auratus, Recombinant (His) is expressed in yeast with C-6xHis tag. The predicted molecular weight is 16.3 kDa and the accession number is Q60440. |
Species | Mesocricetus auratus |
Expression System | P. pastoris (Yeast) |
Tag | C-6xHis |
Accession Number | Q60440 |
Synonyms | Lymphocyte stimulatory factor 1,Interleukin-4,IL-4,IL4,B-cell stimulatory factor 1 (BSF-1) |
Amino Acid | NWTLGCHHGALKEIIHILNQVTEKGTPCTEMVVPDALSARKNSTEKDLICRASQGFRKFYFQHEVTLCLKNNSRVLKDLKKLYRGISSLFPQKSCNVNESTYTTLKDFLESLRRIMQKKYWQCGSSTF |
Construction | 20-147 aa |
Protein Purity | > 90% as determined by SDS-PAGE. |
Molecular Weight | 16.3 kDa (predicted) |
Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
Formulation | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
Shipping | In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice. |
Research Background | Participates in at least several B-cell activation processes as well as of other cell types. It is a costimulator of DNA-synthesis. It induces the expression of class II MHC molecules on resting B-cells. It enhances both secretion and cell surface expression of IgE and IgG1. It also regulates the expression of the low affinity Fc receptor for IgE (CD23) on both lymphocytes and monocytes. Positively regulates IL31RA expression in macrophages. Stimulates autophagy in dendritic cells by interfering with mTORC1 signaling and through the induction of RUFY4. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.