Shopping Cart
- Remove All
- Your shopping cart is currently empty
IL-4 Protein, Sheep, Recombinant (B2M & His & Myc) is expressed in E. coli expression system with N-10XHis-B2M and C-Myc tag. The predicted molecular weight is 29.6 kDa and the accession number is P30368.
Pack Size | Price | Availability | Quantity |
---|---|---|---|
20 μg | $360 | 20 days | |
100 μg | $678 | 20 days | |
1 mg | $2,300 | 20 days |
Biological Activity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first. |
Description | IL-4 Protein, Sheep, Recombinant (B2M & His & Myc) is expressed in E. coli expression system with N-10XHis-B2M and C-Myc tag. The predicted molecular weight is 29.6 kDa and the accession number is P30368. |
Species | Sheep |
Expression System | E. coli |
Tag | N-10XHis-B2M, C-Myc |
Accession Number | P30368 |
Synonyms | Lymphocyte stimulatory factor 1,Interleukin-4,IL4,B-cell stimulatory factor 1 |
Amino Acid | HKCDITLEEIIKTLNILTSRKNSCMELPVADVFAAPKNATEKETFCRAGIELRRIYRSHMCLNKFLGGLDRNLSSLASKTCSVNEAKTSTSTLRDLLERLKTIMREKYSKC |
Construction | 25-135 aa |
Protein Purity | > 90% as determined by SDS-PAGE. |
Molecular Weight | 29.6 kDa (predicted) |
Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
Formulation | Tris-based buffer, 50% glycerol |
Reconstitution | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
Shipping | In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice. |
Research Background | Participates in at least several B-cell activation processes as well as of other cell types. It is a costimulator of DNA-synthesis. It induces the expression of class II MHC molecules on resting B-cells. It enhances both secretion and cell surface expression of IgE and IgG1. It also regulates the expression of the low affinity Fc receptor for IgE (CD23) on both lymphocytes and monocytes. Positively regulates IL31RA expression in macrophages. Stimulates autophagy in dendritic cells by interfering with mTORC1 signaling and through the induction of RUFY4. |
Copyright © 2015-2024 TargetMol Chemicals Inc. All Rights Reserved.