Shopping Cart
  • Remove All
  • TargetMol
    Your shopping cart is currently empty

IL-4 Protein, Sheep, Recombinant (B2M & His & Myc)

Catalog No. TMPH-03498

IL-4 Protein, Sheep, Recombinant (B2M & His & Myc) is expressed in E. coli expression system with N-10XHis-B2M and C-Myc tag. The predicted molecular weight is 29.6 kDa and the accession number is P30368.

IL-4 Protein, Sheep, Recombinant (B2M & His & Myc)

IL-4 Protein, Sheep, Recombinant (B2M & His & Myc)

Catalog No. TMPH-03498
IL-4 Protein, Sheep, Recombinant (B2M & His & Myc) is expressed in E. coli expression system with N-10XHis-B2M and C-Myc tag. The predicted molecular weight is 29.6 kDa and the accession number is P30368.
Pack SizePriceAvailabilityQuantity
20 μg $36020 days
100 μg $74520 days
1 mg $2,53020 days
Bulk & Custom
Add to Cart
Questions
View More
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
IL-4 Protein, Sheep, Recombinant (B2M & His & Myc) is expressed in E. coli expression system with N-10XHis-B2M and C-Myc tag. The predicted molecular weight is 29.6 kDa and the accession number is P30368.
Species
Sheep
Expression System
E. coli
TagN-10XHis-B2M, C-Myc
Accession NumberP30368
Synonyms
Lymphocyte stimulatory factor 1,Interleukin-4,IL4,B-cell stimulatory factor 1
Amino Acid
HKCDITLEEIIKTLNILTSRKNSCMELPVADVFAAPKNATEKETFCRAGIELRRIYRSHMCLNKFLGGLDRNLSSLASKTCSVNEAKTSTSTLRDLLERLKTIMREKYSKC
Construction
25-135 aa
Protein Purity
> 90% as determined by SDS-PAGE.
Molecular Weight29.6 kDa (predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationTris-based buffer, 50% glycerol
Reconstitution
A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.
Research Background
Participates in at least several B-cell activation processes as well as of other cell types. It is a costimulator of DNA-synthesis. It induces the expression of class II MHC molecules on resting B-cells. It enhances both secretion and cell surface expression of IgE and IgG1. It also regulates the expression of the low affinity Fc receptor for IgE (CD23) on both lymphocytes and monocytes. Positively regulates IL31RA expression in macrophages. Stimulates autophagy in dendritic cells by interfering with mTORC1 signaling and through the induction of RUFY4.

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.