{val1}-exendin-3/4

{Val1}- exendin-3/4 is the first n-terminal 1-28 residue of exendin-4 peptide.

ACTH 1-14 acetate(25696-21-3 free base) (Adrenocorticotropic Hormone Fragment 1-14 acetate) is a fragment of adrenocorticotrophin, which regulates cortisol and androgen production.Adrenocorticotropic hormone (ACTH), also known as corticotropin, is produced and secreted by the anterior pituitary gland. ACTH is an important component of the hypothalamic-pituitary-adrenal axis as a response to biological stress.

Dynorphin A (1-10) acetate is an endogenous opioid neuropeptide, binds to extracellular loop 2 of the κ-opioid receptor. Dynorphin A (1-10) also blocks NMDA-activated current with an IC50 of 42.0 μM.

γ-1-MSH, amide acetate (72629-65-3 free base), a putative hormone in the N-terminal region of the ACTH/beta- endorphin (beta-EP) precursor protein, was studied by RIA with an antiserum against gamma 3-MSH in ACTH-producing mouse pituitary tumor cells, AtT-20/D16v.

Acth (1-4) acetate is the ACTH N-terminal tetrapeptide.

b-Casomorphin (1-3) Acetate is a tri-peptide with an opioid effect.

Exendin-4 (Exenatide) is a glucagon-like peptide-1 receptor (GLP-1) agonist (IC50: 3.22 nM). Exenatide is a 39 amino acid peptide. Compared to GLP-1, exenatide has a longer half-life of 2.4 hours.

Angiotensin II is a potent direct vasoconstrictor, causing arteries and veins to constrict, so leading to an increase in blood pressure. Angiotensin also potentiates the release of norepinephrine by a direct action on postganglionic sympathetic fibers.

[D-Arg2]Dermorphin-(1-4) amide is an N-terminal truncated peptide of [D-Arg2]dermorphin noted for its hypothermic and analgesic effects. This compound also demonstrates degradation when subjected to soluble mouse liver and brain extracts [1].

Exendin-4 (3-39) is a truncated peptide variant of Exendin-4, missing the initial two amino acids, and serves as a potent agonist for the Glucagon-like peptide-1 receptor (GLP-1r). This compound, along with Exendin-4, is utilized in the study of diabetes and hypothalamic-pituitary-adrenal (HPA) axis disorders [1] [2].

Substance P(1-4) acts as a potent antagonist of neurokinin receptors (NK-R) and regulates normal hematopoiesis, additionally inhibiting the formation of endogenous erythroid colonies (EEC) [1].

Exendin-3/4 (64-86) is a polypeptide.

Dynorphin A (1-10) (TFA), an endogenous opioid neuropeptide, binds in the transmembrane domain of the κ-receptor.

Bradykinin (1-3) is a fragment of Bradykinin. Bradykinin is an activates pain receptors.

Gastric inhibitory peptide 1 (GIP-1) (3-42), a fragment of the incretin hormone GIP and antagonist to the GIP receptor, is generated through the action of serum dipeptidyl peptidase 4 (DDP-4). When administered at 25 nmol/kg to an ob/ob mouse diabetes model, GIP-1 (3-42) elevates plasma glucose levels and lowers plasma insulin levels, demonstrating its effect on reducing insulin secretion from BRIN-BD11 pancreatic cells at a concentration of 100 nM.

SDV-Exendin-3/4 is a 32-amino acid peptide.

(2S,4R)-1-(((9H-Fluoren-9-yl)methoxy)carbonyl)-4-(tert-butoxy)pyrrolidine-2-carboxylic acid is a useful organic compound for research related to life sciences. The catalog number is T67625 and the CAS number is 122996-47-8.

PAR 4 (1-6) TFA (GYPGQV TFA), a hexapeptide derived from protease-activated receptor 4 (PAR 4), serves as a specific agonist for PAR 4. This fragment of PAR 4 [1] exhibits targeted activation properties.

Acth (1-4) is the ACTH N-terminal tetrapeptide.

(R)-3-Amino-4-(benzyloxy)-4-oxobutanoic acid is a useful organic compound for research related to life sciences. The catalog number is T66671 and the CAS number is 79337-40-9.

(S)-3-(4-Bromophenyl)-3-((tert-butoxycarbonyl)amino)propanoic acid is a useful organic compound for research related to life sciences. The catalog number is T65894 and the CAS number is 261165-06-4.

(S)-1-Benzyl 2-methyl 4-oxopyrrolidine-1,2-dicarboxylate is a useful organic compound for research related to life sciences. The catalog number is T66075 and the CAS number is 16217-15-5.

ACTH (1-14) (TFA) is a polypeptide of corticotrophin, which promotes the release of cortisol.

2-((3-Fluoro-4-(methylcarbamoyl)phenyl)amino)-2-methylpropanoic acid is a useful organic compound for research related to life sciences. The catalog number is T66529 and the CAS number is 1289942-66-0.

(S)-3-Amino-4-hydroxybutanoic acid is a useful organic compound for research related to life sciences. The catalog number is T65786 and the CAS number is 16504-57-7.

(S)-2,5-Dioxopyrrolidin-1-yl 2-(((benzyloxy)carbonyl)amino)-3-methylbutanoate is a useful organic compound for research related to life sciences. The catalog number is T64925 and the CAS number is 3496-11-5.

MART-1 (26-35) (human) TFA is an amino acid residue of 26-35 protein.

β-Casomorphin (1-3), amide is a peptide fragment of β-Casomorphin with 3 amino acid.

Angiotensin I, asn(1)-val(5)-gly(9)- is isolated from the plasma of American eel, Anquilla rostrata.

(S)-2-(Cbz-amino)-3-phenyl-1-propanol is a useful organic compound for research related to life sciences. The catalog number is T67603 and the CAS number is 6372-14-1.

(S)-2-((R)-2-Amino-4-methylpentanamido)-3-(4-hydroxyphenyl)propanoic acid hydrate is a useful organic compound for research related to life sciences. The catalog number is T65137 and the CAS number is 3303-29-5.

Exendin derivative 1 is a 39 amino acid peptide.

(R)-2-Amino-3-(4-fluorophenyl)propanoic acid is a useful organic compound for research related to life sciences. The catalog number is T64973 and the CAS number is 18125-46-7.

(S)-2-(2-Aminoacetamido)-3-(1H-imidazol-4-yl)propanoic acid is a useful organic compound for research related to life sciences. The catalog number is T66955 and the CAS number is 2489-13-6.

TFRGAP-amide, human PAR-3-derived tethered ligand sequence which does not activate PAR-3 but rather activates PAR-1 and PAR-2, either in Jurkat or in other PAR-expressing cells.

(S)-2-((tert-Butoxycarbonyl)amino)-3-(4-ethoxyphenyl)propanoic acid is a useful organic compound for research related to life sciences. The catalog number is T65592 and the CAS number is 76757-91-0.

(2S,4S)-1-(tert-Butoxycarbonyl)-4-(methoxymethyl)pyrrolidine-2-carboxylic acid is a useful organic compound for research related to life sciences. The catalog number is T66636 and the CAS number is 1378388-16-9.

(S)-2-((tert-Butoxycarbonyl)amino)-3-(4-carbamoyl-2,6-dimethylphenyl)propanoic acid is a useful organic compound for research related to life sciences. The catalog number is T66476 and the CAS number is 623950-02-7.

Des His1, Glu8 Exendin-4 is a potent antagonist of the glucagon-like peptide-1 receptor (GLP-1-R), enhancing glucose homeostasis through the dual regulation of insulin secretion and glucose production. This compound is employed in research on type 2 diabetes and gastrointestinal disorders [1].

(S)-3-Amino-4-methoxy-4-oxobutanoic acid is a useful organic compound for research related to life sciences. The catalog number is T65813 and the CAS number is 17812-32-7.

(2R,4R)-1-(tert-Butoxycarbonyl)-4-fluoropyrrolidine-2-carboxylic acid is a useful organic compound for research related to life sciences. The catalog number is T66514 and the CAS number is 681128-51-8.

Protease-Activated Receptor-3 (PAR-3) (1-6), human TFA is a peptide that acts as an agonist for the proteinase-activated receptor (PAR-3)[1].

2-Amino-3-(3-fluoro-4-hydroxyphenyl)propanoic acid is a useful organic compound for research related to life sciences. The catalog number is T64974 and the CAS number is 403-90-7.

FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.Exendin-4 peptide derivatives are structurally derived from Exendin-4 and may relates to dual GLP-1/glucagon receptor agonists.

(S)-2-((tert-Butoxycarbonyl)amino)-3-(4-nitrophenyl)propanoic acid is a useful organic compound for research related to life sciences. The catalog number is T65933 and the CAS number is 33305-77-0.

(R)-3-Amino-4-hydroxybutanoic acid is a useful organic compound for research related to life sciences. The catalog number is T65787 and the CAS number is 16504-56-6.

(R)-Methyl 2-amino-3-(4-chlorophenyl)propanoate hydrochloride is a useful organic compound for research related to life sciences. The catalog number is T65936 and the CAS number is 33965-47-8.

2-((tert-Butoxycarbonyl)amino)-3-(4-chlorophenyl)propanoic acid is a useful organic compound for research related to life sciences. The catalog number is T66794 and the CAS number is 51301-86-1.

(S)-2-((((9H-Fluoren-9-yl)methoxy)carbonyl)amino)-3-(4-((tert-butoxycarbonyl)amino)phenyl)propanoic acid is a useful organic compound for research related to life sciences. The catalog number is T66719 and the CAS number is 174132-31-1.

(3R,4R)-4-(Benzyloxy)-3-((tert-butoxycarbonyl)amino)pentanoic acid is a useful organic compound for research related to life sciences. The catalog number is T65040 and the CAS number is 254101-11-6.