exendin 3/4 (64 86)

Exendin-3 4 (64-86) is a polypeptide composed of a specific amino acid sequence within the exendin-3 or exendin-4 peptide chains.

Exendin-4 (Exenatide) is a glucagon-like peptide-1 receptor (GLP-1) agonist (IC50: 3.22 nM). Exenatide is a 39 amino acid peptide. Compared to GLP-1, exenatide has a longer half-life of 2.4 hours.

Exendin-4 acetate is a 39 amino acid peptide.Exendin-4 acetate is a long-acting GLP-1 receptor agonist(IC50 = 3.22 nM).

(R)-3-Amino-4-(benzyloxy)-4-oxobutanoic acid is a useful organic compound for research related to life sciences. The catalog number is T66671 and the CAS number is 79337-40-9.

(S)-3-(4-Bromophenyl)-3-((tert-butoxycarbonyl)amino)propanoic acid, with catalog number T65894 and CAS number 261165-06-4, is a valuable organic compound for life sciences research.

2-((3-Fluoro-4-(methylcarbamoyl)phenyl)amino)-2-methylpropanoic acid is a valuable organic compound for life sciences research [Catalog No. T66529, CAS No. 1289942-66-0].

SDV-Exendin-3 4 is a 32-amino acid peptide. Derived from the salivary gland of the Gila monster (Heloderma suspectum), this peptide is a ligand for the GLP-1 receptor, playing a key role in glucose metabolism and insulin secretion. It exhibits significant potential for therapeutic applications in diabetes management.

(S)-3-Amino-4-hydroxybutanoic acid, with catalog number T65786 and CAS number 16504-57-7, is a valuable organic compound for life sciences research.

(S)-2-((R)-2-Amino-4-methylpentanamido)-3-(4-hydroxyphenyl)propanoic acid hydrate is a valuable organic compound for life sciences research (catalog number T65137, CAS number 3303-29-5).

FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.Exendin-4 peptide derivatives are structurally derived from Exendin-4 and may relates to dual GLP-1/glucagon receptor agonists.

(R)-2-Amino-3-(4-fluorophenyl)propanoic acid is a useful organic compound for research related to life sciences. The catalog number is T64973 and the CAS number is 18125-46-7.

(S)-2-(2-Aminoacetamido)-3-(1H-imidazol-4-yl)propanoic acid is a valuable organic compound for life sciences research, catalog number T66955, CAS number 2489-13-6.

(S)-2-((tert-Butoxycarbonyl)amino)-3-(4-ethoxyphenyl)propanoic acid is an important organic compound used in life sciences research, catalog number T65592 and CAS number 76757-91-0.

(S)-2-((tert-Butoxycarbonyl)amino)-3-(4-carbamoyl-2,6-dimethylphenyl)propanoic acid is a useful organic compound for research related to life sciences. The catalog number is T66476 and the CAS number is 623950-02-7.

Des His1, Glu8 Exendin-4 is a glucagon-like peptide-1 receptor (GLP-1-R) antagonist that regulates blood glucose. Des His1, Glu8 Exendin-4 is used in the study of diabetes and obesity.

(S)-3-Amino-4-methoxy-4-oxobutanoic acid is a useful organic compound for research related to life sciences. The catalog number is T65813 and the CAS number is 17812-32-7.

2-Amino-3-(3-fluoro-4-hydroxyphenyl)propanoic acid is a valuable organic compound for life sciences research (Catalog No.: T64974, CAS No.: 403-90-7).

{Val1}- exendin-3/4 is the first n-terminal 1-28 residue of exendin-4 peptide.

(S)-2-((tert-Butoxycarbonyl)amino)-3-(4-nitrophenyl)propanoic acid, catalog number T65933 and CAS number 33305-77-0, is a valuable organic compound for life sciences research.

(R)-3-Amino-4-hydroxybutanoic acid, with catalog number T65787 and CAS number 16504-56-6, is a valuable compound for life sciences research.

(R)-Methyl 2-amino-3-(4-chlorophenyl)propanoate hydrochloride is a useful organic compound for research related to life sciences. The catalog number is T65936 and the CAS number is 33965-47-8.

2-((tert-Butoxycarbonyl)amino)-3-(4-chlorophenyl)propanoic acid is a valuable organic compound used in life sciences research [Catalog No. T66794, CAS No. 51301-86-1].

(S)-2-((((9H-Fluoren-9-yl)methoxy)carbonyl)amino)-3-(4-((tert-butoxycarbonyl)amino)phenyl)propanoic acid is a valuable organic compound for life sciences research [Catalog No. T66719, CAS No. 174132-31-1].

(3R,4R)-4-(Benzyloxy)-3-((tert-butoxycarbonyl)amino)pentanoic acid is a useful organic compound for research related to life sciences. The catalog number is T65040 and the CAS number is 254101-11-6.

2-Amino-3-(2-oxo-1,2-dihydroquinolin-4-yl)propanoic acid hydrochloride is a valuable organic compound for life sciences research. [Catalog number: T64780, CAS number: 4876-14-6].

(S)-2-((((9H-Fluoren-9-yl)methoxy)carbonyl)amino)-3-(1-trityl-1H-imidazol-4-yl)propanoic acid is a useful organic compound for research related to life sciences. The catalog number is T67561 and the CAS number is 109425-51-6.

Exendin-3 4 (59-86) is a derivative of the Exendin-4 peptide.

(R)-2-Amino-3-(3,5-dibromo-4-hydroxyphenyl)propanoic acid is a useful organic compound for research related to life sciences. The catalog number is T66789 and the CAS number is 50299-42-8.

(S)-2-((((9H-Fluoren-9-yl)methoxy)carbonyl)amino)-3-(4-(2-(tert-butoxy)-2-oxoethoxy)phenyl)propanoic acid is a useful organic compound for research related to life sciences. The catalog number is T65174 and the CAS number is 181951-92-8.

(S)-2-Amino-3-(3-bromo-4-hydroxyphenyl)propanoic acid is a useful organic compound for research related to life sciences. The catalog number is T66863 and the CAS number is 38739-13-8.

(R)-2-((((9H-Fluoren-9-yl)methoxy)carbonyl)amino)-3-(1H-imidazol-4-yl)propanoic acid is a useful organic compound for research related to life sciences. The catalog number is T66021 and the CAS number is 157355-79-8.

Exendin-3 is a biologically active peptide and pancreatic secretagogue from the glucagon family, isolated from the venoms of Gila monster lizards (Heloderma horridurn).

Exendin-4 (3-39) is a truncated peptide variant of Exendin-4, missing the initial two amino acids, and serves as a potent agonist for the Glucagon-like peptide-1 receptor (GLP-1r). This compound, along with Exendin-4, is utilized in the study of diabetes and hypothalamic-pituitary-adrenal (HPA) axis disorders [1] [2].

(R)-3-(4-Bromophenyl)-3-((tert-butoxycarbonyl)amino)propanoic acid is a valuable organic compound utilized in life sciences research. It is cataloged under number T65895 and has a CAS number of 261380-20-5.

Methyl 2-((3-fluoro-4-(methylcarbamoyl)phenyl)amino)-2-methylpropanoate is a valuable organic compound for life sciences research (catalog number: T66530, CAS number: 1332524-01-2).

Exendin-4 peptide derivative acetate is an acetate salt of Exendin-4 peptide derivative.

(S)-Benzyl 2-((tert-butoxycarbonyl)amino)-3-(4-hydroxyphenyl)propanoate is a useful organic compound for research related to life sciences. The catalog number is T65049 and the CAS number is 19391-35-6.

Methyl 2-amino-3-(4-hydroxyphenyl)-2-methylpropanoate hydrochloride is a useful organic compound for research related to life sciences. The catalog number is T64983 and the CAS number is 7361-31-1.

(S)-2-Amino-3-(4-hydroxy-2,6-dimethylphenyl)propanoic acid is a useful organic compound for research related to life sciences. The catalog number is T67015 and the CAS number is 123715-02-6.

(S)-3-([1,1'-Biphenyl]-4-yl)-2-aminopropanoic acid is a useful organic compound for research related to life sciences. The catalog number is T64737 and the CAS number is 155760-02-4.

(S)-2-Amino-3-(pyridin-4-yl)propanoic acid dihydrochloride is a valuable organic compound for life sciences research (catalog number T66893, CAS number 178933-04-5).

2-Amino-3-(4-fluorophenyl)propanoic acid is a valuable organic compound for life sciences research (catalog number: T67307, CAS number: 51-65-0).

(R)-2-(((Benzyloxy)carbonyl)amino)-3-(4-hydroxyphenyl)propanoic acid is a useful organic compound for research related to life sciences. The catalog number is T66819 and the CAS number is 64205-12-5.

(S)-3-(((Benzyloxy)carbonyl)amino)-4-methoxy-4-oxobutanoic acid is a useful organic compound for research related to life sciences. The catalog number is T65984 and the CAS number is 4668-42-2.