exendin-4 peptide derivative

FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.Exendin-4 peptide derivatives are structurally derived from Exendin-4 and may relates to dual GLP-1/glucagon receptor agonists.

Exendin-4 peptide derivative acetate is an acetate salt of Exendin-4 peptide derivative.

Exendin-4 (Exenatide) is a glucagon-like peptide-1 receptor (GLP-1) agonist (IC50: 3.22 nM). Exenatide is a 39 amino acid peptide. Compared to GLP-1, exenatide has a longer half-life of 2.4 hours.

VSV-G Peptide acetate(103425-05-4 free base) is a 11 amino acid peptide derived from the Vesicular Stomatitis viral glycoprotein.

Exendin-3 4 (64-86) is a polypeptide composed of a specific amino acid sequence within the exendin-3 or exendin-4 peptide chains.

Exendin-4 acetate is a 39 amino acid peptide.Exendin-4 acetate is a long-acting GLP-1 receptor agonist(IC50 = 3.22 nM).

PAR-4 Agonist Peptide, amide TFA (PAR-4-AP (TFA)), is a selective activator of the proteinase-activated receptor-4 (PAR-4) that does not affect PAR-1 or PAR-2, and its activity can be inhibited by a PAR-4 antagonist.

Exendin-3 4 (59-86) is a derivative of the Exendin-4 peptide.

SDV-Exendin-3 4 is a 32-amino acid peptide. Derived from the salivary gland of the Gila monster (Heloderma suspectum), this peptide is a ligand for the GLP-1 receptor, playing a key role in glucose metabolism and insulin secretion. It exhibits significant potential for therapeutic applications in diabetes management.

Exendin derivative 1, a 39-amino acid peptide, is a chemical compound known for its significant biological activity and therapeutic potential.

PKCα (C2-4) inhibitor peptide is a specific antagonist to PKCα, preventing the α1A-adrenoreceptor agonist A-61603 [1] from inhibiting I_Kr.

Exendin-4 (3-39) is a truncated peptide variant of Exendin-4, missing the initial two amino acids, and serves as a potent agonist for the Glucagon-like peptide-1 receptor (GLP-1r). This compound, along with Exendin-4, is utilized in the study of diabetes and hypothalamic-pituitary-adrenal (HPA) axis disorders [1] [2].

Bombinin-like peptide 4, an antimicrobial peptide, originates from the skin secretions of the Asian toad (Bombina orientalis) [1].

SLLK, Control Peptide for TSP1 Inhibitor (TFA) is a control peptide for LSKL, which is a Thrombospondin (TSP-1) inhibitor.

PAR-4 Agonist Peptide, amide (AY-NH2), is an agonist of proteinase-activated receptor-4 (PAR-4).

Ac-MBP (4-14) Peptide, an acetylated form of the MBP (4-14) peptide, serves as a highly selective substrate for (protein kinase C) PKC. It facilitates PKC assays in extracts without the need for prior purification to remove interfering protein kinases or phosphatases [1].

Des His1, Glu8 Exendin-4 is a glucagon-like peptide-1 receptor (GLP-1-R) antagonist that regulates blood glucose. Des His1, Glu8 Exendin-4 is used in the study of diabetes and obesity.

PAR-4 Agonist Peptide, amide acetate is an agonist of proteinase-activated receptor-4 (PAR-4).

{Val1}- exendin-3/4 is the first n-terminal 1-28 residue of exendin-4 peptide.

GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.

FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.