par-4 agonist peptide, amide

PAR-4 Agonist Peptide, amide (AY-NH2), is an agonist of proteinase-activated receptor-4 (PAR-4).

PAR-4 Agonist Peptide, amide acetate is an agonist of proteinase-activated receptor-4 (PAR-4).

PAR-4 Agonist Peptide, amide TFA (PAR-4-AP (TFA)), is a selective activator of the proteinase-activated receptor-4 (PAR-4) that does not affect PAR-1 or PAR-2, and its activity can be inhibited by a PAR-4 antagonist.

PAR-2 Activating Peptide acetate (SLIGRL-NH2 acetate) is an agonist of Protease-Activated Receptor-2 (PAR-2).

Protease-Activated Receptor-1, PAR-1 Agonist acetate is a selective proteinase-activated receptor1 (PAR-1) agonist peptide. Protease-Activated Receptor-1, PAR-1 Agonist acetate corresponds to PAR1 tethered ligand and which can selectively mimic theactions of thrombin via this receptor[1][2].

VSV-G Peptide acetate(103425-05-4 free base) is a 11 amino acid peptide derived from the Vesicular Stomatitis viral glycoprotein.

Ribosomal protein L3 peptide (202-222) is a peptide with the sequenceH2N-Met-Ser-His-Arg-Lys-Tyr-Glu-Ala-Pro-Arg-His-Gly-His-Leu-Gly-Phe-Leu-Pro-Arg-Lys-Arg-amide, MW=2573.

PAR 4 (1-6) TFA (GYPGQV TFA), a hexapeptide derived from protease-activated receptor 4 (PAR 4), serves as a specific agonist for PAR 4, exhibiting targeted activation properties.

Protease-Activated Receptor-1 (PAR-1) Agonist, a selective peptide, activates the PAR-1 receptor by mimicking the specific actions of thrombin. It corresponds to the PAR1 tethered ligand, facilitating selective activation of this receptor.

Galanin message-associated peptide (1-41) amide is a peptide hormone [1].

PKCα (C2-4) inhibitor peptide is a specific antagonist to PKCα, preventing the α1A-adrenoreceptor agonist A-61603 [1] from inhibiting I_Kr.

Bombinin-like peptide 4, an antimicrobial peptide, originates from the skin secretions of the Asian toad (Bombina orientalis) [1].

[D-Arg2]Dermorphin-(1-4) amide is an N-terminal truncated peptide of [D-Arg2]dermorphin known for its hypothermic and analgesic effects, and it demonstrates degradation when exposed to soluble mouse liver and brain extracts [1].

Peptide T amide is an octapeptide segment of HIV envelope gp120 and is used in AIDS therapy.

SLLK, Control Peptide for TSP1 Inhibitor (TFA) is a control peptide for LSKL, which is a Thrombospondin (TSP-1) inhibitor.

Acetyl-Tau Peptide (273-284) amide, an acetylated fragment of the Tau peptide, inhibits the significant aggregation of Ac-Aβ(25–35)-NH2 and serves as a model for studying the cross-interaction between Aβ and Tau [1] [2].

Human glucagon-like peptide-1-(7-36)-Lys(Biotin) amide, a biotin-labeled variant of glucagon-like peptide-1-(7-36), is a gastrointestinal peptide known for its antidiabetogenic properties, including enhancing insulin secretion [1] [2].

Protease-Activated Receptor-1 (PAR-1) Agonist TFA is a selective peptide that acts as an agonist for the proteinase-activated receptor-1 (PAR-1). Corresponding to the tethered ligand of PAR-1, this compound mimics the actions of thrombin through the PAR-1 receptor[1][2].

Exendin-4 peptide derivative acetate is an acetate salt of Exendin-4 peptide derivative.

Ac-MBP (4-14) Peptide, an acetylated form of the MBP (4-14) peptide, serves as a highly selective substrate for (protein kinase C) PKC. It facilitates PKC assays in extracts without the need for prior purification to remove interfering protein kinases or phosphatases [1].

FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.Exendin-4 peptide derivatives are structurally derived from Exendin-4 and may relates to dual GLP-1/glucagon receptor agonists.

Glucagon-Like Peptide 1 (GLP-1) (7-36)-Lys (Biotin), amide, human, is a human GLP-1 (7-36) amide biotinylated at the C-terminal.

PAR2 (1-6) amide is a synthetic peptide agonist of proteinase-activated receptor 2 (PAR2) that corresponds to residues 1-6 of the amino terminal tethered ligand sequence of human PAR2 and residues 37-42 of the full-length sequence.1It binds to NCTC 2544 cells expressing human PAR2 (Ki= 9.64 μM in a radioligand binding assay) and induces calcium mobilization in the same cells (EC50= 0.075 μM).2PAR2 (1-6) amide (100 μM) reduces colony formation of A549 lung cancer cells.1It induces superoxide production and degranulation in isolated human eosinophils when used at a concentration of 500 μM.3PAR2 (1-6) amide (5 μmol/kg) induces tear secretion in rats when used in combination with amastatin .4 1.Bohm, S.K., Kong, W., Bromme, D., et al.Molecular cloning, expression and potential functions of the human proteinase-activated receptor-2Biochem. J.314(Pt 3)1009-1016(1996) 2.Kanke, T., Ishiwata, H., Kabeya, M., et al.Binding of a highly potent protease-activated receptor-2 (PAR2) activating peptide, [3H]2-furoyl-LIGRL-NH2, to human PAR2Br. J. Pharmacol.145(2)255-263(2005) 3.Miike, S., McWilliam, A.S., and Kita, H.Trypsin induces activation and inflammatory mediator release from human eosinophils through protease-activated receptor-2J. Immunol.167(11)6615-6622(2001) 4.Nishikawa, H., Kawai, K., Tanaka, M., et al.Protease-activated receptor-2 (PAR-2)-related peptides induce tear secretion in rats: Involvement of PAR-2 and non-PAR-2 mechanismsJ. Pharmacol. Exp. Ther.312(2)324-331(2005)