sdv exendin 3/4

SDV-Exendin-3/4 is a 32-amino acid peptide.

Exendin-4 (Exenatide) is a glucagon-like peptide-1 receptor (GLP-1) agonist (IC50: 3.22 nM). Exenatide is a 39 amino acid peptide. Compared to GLP-1, exenatide has a longer half-life of 2.4 hours.

Exendin-4 (3-39) is a truncated peptide variant of Exendin-4, missing the initial two amino acids, and serves as a potent agonist for the Glucagon-like peptide-1 receptor (GLP-1r). This compound, along with Exendin-4, is utilized in the study of diabetes and hypothalamic-pituitary-adrenal (HPA) axis disorders [1] [2].

Exendin-3/4 (64-86) is a polypeptide.

(R)-3-Amino-4-(benzyloxy)-4-oxobutanoic acid is a useful organic compound for research related to life sciences. The catalog number is T66671 and the CAS number is 79337-40-9.

(S)-3-(4-Bromophenyl)-3-((tert-butoxycarbonyl)amino)propanoic acid is a useful organic compound for research related to life sciences. The catalog number is T65894 and the CAS number is 261165-06-4.

2-((3-Fluoro-4-(methylcarbamoyl)phenyl)amino)-2-methylpropanoic acid is a useful organic compound for research related to life sciences. The catalog number is T66529 and the CAS number is 1289942-66-0.

(S)-3-Amino-4-hydroxybutanoic acid is a useful organic compound for research related to life sciences. The catalog number is T65786 and the CAS number is 16504-57-7.

(S)-2-((R)-2-Amino-4-methylpentanamido)-3-(4-hydroxyphenyl)propanoic acid hydrate is a useful organic compound for research related to life sciences. The catalog number is T65137 and the CAS number is 3303-29-5.

(R)-2-Amino-3-(4-fluorophenyl)propanoic acid is a useful organic compound for research related to life sciences. The catalog number is T64973 and the CAS number is 18125-46-7.

(S)-2-(2-Aminoacetamido)-3-(1H-imidazol-4-yl)propanoic acid is a useful organic compound for research related to life sciences. The catalog number is T66955 and the CAS number is 2489-13-6.

(S)-2-((tert-Butoxycarbonyl)amino)-3-(4-ethoxyphenyl)propanoic acid is a useful organic compound for research related to life sciences. The catalog number is T65592 and the CAS number is 76757-91-0.

(S)-2-((tert-Butoxycarbonyl)amino)-3-(4-carbamoyl-2,6-dimethylphenyl)propanoic acid is a useful organic compound for research related to life sciences. The catalog number is T66476 and the CAS number is 623950-02-7.

{Val1}- exendin-3/4 is the first n-terminal 1-28 residue of exendin-4 peptide.

Des His1, Glu8 Exendin-4 is a potent antagonist of the glucagon-like peptide-1 receptor (GLP-1-R), enhancing glucose homeostasis through the dual regulation of insulin secretion and glucose production. This compound is employed in research on type 2 diabetes and gastrointestinal disorders [1].

(S)-3-Amino-4-methoxy-4-oxobutanoic acid is a useful organic compound for research related to life sciences. The catalog number is T65813 and the CAS number is 17812-32-7.

2-Amino-3-(3-fluoro-4-hydroxyphenyl)propanoic acid is a useful organic compound for research related to life sciences. The catalog number is T64974 and the CAS number is 403-90-7.

FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.Exendin-4 peptide derivatives are structurally derived from Exendin-4 and may relates to dual GLP-1/glucagon receptor agonists.

(S)-2-((tert-Butoxycarbonyl)amino)-3-(4-nitrophenyl)propanoic acid is a useful organic compound for research related to life sciences. The catalog number is T65933 and the CAS number is 33305-77-0.

(R)-3-Amino-4-hydroxybutanoic acid is a useful organic compound for research related to life sciences. The catalog number is T65787 and the CAS number is 16504-56-6.

(R)-Methyl 2-amino-3-(4-chlorophenyl)propanoate hydrochloride is a useful organic compound for research related to life sciences. The catalog number is T65936 and the CAS number is 33965-47-8.

2-((tert-Butoxycarbonyl)amino)-3-(4-chlorophenyl)propanoic acid is a useful organic compound for research related to life sciences. The catalog number is T66794 and the CAS number is 51301-86-1.

(S)-2-((((9H-Fluoren-9-yl)methoxy)carbonyl)amino)-3-(4-((tert-butoxycarbonyl)amino)phenyl)propanoic acid is a useful organic compound for research related to life sciences. The catalog number is T66719 and the CAS number is 174132-31-1.

(3R,4R)-4-(Benzyloxy)-3-((tert-butoxycarbonyl)amino)pentanoic acid is a useful organic compound for research related to life sciences. The catalog number is T65040 and the CAS number is 254101-11-6.

2-Amino-3-(2-oxo-1,2-dihydroquinolin-4-yl)propanoic acid hydrochloride is a useful organic compound for research related to life sciences. The catalog number is T64780 and the CAS number is 4876-14-6.

(S)-2-((((9H-Fluoren-9-yl)methoxy)carbonyl)amino)-3-(1-trityl-1H-imidazol-4-yl)propanoic acid is a useful organic compound for research related to life sciences. The catalog number is T67561 and the CAS number is 109425-51-6.

Exendin-3/4 (59-86) is a Exendin-4 peptide derivative.

(R)-2-Amino-3-(3,5-dibromo-4-hydroxyphenyl)propanoic acid is a useful organic compound for research related to life sciences. The catalog number is T66789 and the CAS number is 50299-42-8.

(S)-2-((((9H-Fluoren-9-yl)methoxy)carbonyl)amino)-3-(4-(2-(tert-butoxy)-2-oxoethoxy)phenyl)propanoic acid is a useful organic compound for research related to life sciences. The catalog number is T65174 and the CAS number is 181951-92-8.

Exendin-3 is a biologically active peptides isolated from venoms of the Gila monster lizards, Heloderma horridurn . Exendin-3 is a pancreatic secretagogue, which is a member of the glucagon family. It is found in the venom of Heloderma horridurn, which i

(S)-2-Amino-3-(3-bromo-4-hydroxyphenyl)propanoic acid is a useful organic compound for research related to life sciences. The catalog number is T66863 and the CAS number is 38739-13-8.

(R)-2-((((9H-Fluoren-9-yl)methoxy)carbonyl)amino)-3-(1H-imidazol-4-yl)propanoic acid is a useful organic compound for research related to life sciences. The catalog number is T66021 and the CAS number is 157355-79-8.

(R)-3-(4-Bromophenyl)-3-((tert-butoxycarbonyl)amino)propanoic acid is a useful organic compound for research related to life sciences. The catalog number is T65895 and the CAS number is 261380-20-5.

Methyl 2-((3-fluoro-4-(methylcarbamoyl)phenyl)amino)-2-methylpropanoate is a useful organic compound for research related to life sciences. The catalog number is T66530 and the CAS number is 1332524-01-2.

(S)-Benzyl 2-((tert-butoxycarbonyl)amino)-3-(4-hydroxyphenyl)propanoate is a useful organic compound for research related to life sciences. The catalog number is T65049 and the CAS number is 19391-35-6.

Methyl 2-amino-3-(4-hydroxyphenyl)-2-methylpropanoate hydrochloride is a useful organic compound for research related to life sciences. The catalog number is T64983 and the CAS number is 7361-31-1.

(S)-2-Amino-3-(4-hydroxy-2,6-dimethylphenyl)propanoic acid is a useful organic compound for research related to life sciences. The catalog number is T67015 and the CAS number is 123715-02-6.

Exendin-4 acetate is a 39 amino acid peptide.Exendin-4 acetate is a long-acting GLP-1 receptor agonist(IC50 = 3.22 nM).

(S)-3-([1,1'-Biphenyl]-4-yl)-2-aminopropanoic acid is a useful organic compound for research related to life sciences. The catalog number is T64737 and the CAS number is 155760-02-4.

(S)-2-Amino-3-(pyridin-4-yl)propanoic acid dihydrochloride is a useful organic compound for research related to life sciences. The catalog number is T66893 and the CAS number is 178933-04-5.

2-Amino-3-(4-fluorophenyl)propanoic acid is a useful organic compound for research related to life sciences. The catalog number is T67307 and the CAS number is 51-65-0.

(R)-2-(((Benzyloxy)carbonyl)amino)-3-(4-hydroxyphenyl)propanoic acid is a useful organic compound for research related to life sciences. The catalog number is T66819 and the CAS number is 64205-12-5.

(S)-3-(((Benzyloxy)carbonyl)amino)-4-methoxy-4-oxobutanoic acid is a useful organic compound for research related to life sciences. The catalog number is T65984 and the CAS number is 4668-42-2.

Exendin-4 peptide derivative acetate is an acetate salt of Exendin-4 peptide derivative.