angiotensin-converting

Angiotensin-converting enzyme (Kininase II) is a zinc-dependent peptidase and extracellular enzyme that acts as a counterbalance to ACE in the renin-angiotensin system.Angiotensin-converting enzyme is a potent vasoconstrictor used in the study of cardiovascular and immune diseases. Angiotensin-converting enzyme is a potent vasoconstrictor used to study cardiovascular and immune diseases.

Acein acetate is a high-affinity angiotensin-converting enzyme (ACE) ligand (Kd = 2.79 nM). Concentrations up to 500 nM had no significant effect on ACE enzyme activity. Enhanced NMDA + D-serine-induced dopamine release from striatal slices in vitro and striatum in vivo.

Tuna AI acetate is an inhibitor of angiotensin-converting enzyme (ACE) in non-competitive manner derived from tuna muscle.

Acetyl Ser-Asp-Lys-Pro is formed in bone marrow cells by enzymatic processing of thymosin β4. It inhibits the entry of pluripotent hemopoietic stem cells into S-phase of the cell cycle and protects against Ara-C lethality in mice.

Abz-FR-K(Dnp)-P-OH acetate is an excellent angiotensin I-converting enzyme (ACE) substrate with a Km value of 4.0 μM and a kcat value of 210s-1.

Hemorphin-7 acetate is a hemorphin peptide, an endogenous opioid peptide derived from the β-chain of hemoglobin. Hemorphin peptides exhibits antinociceptive and antihypertensive activities, activating opioid receptors and inhibiting angiotensin-converting enzyme (ACE).

H-Ile-Pro-Pro-OH acetate is a angiotensin-converting enzyme inhibitor (ACE) of milk-derived tripeptides.

Acein is a High affinity angiotensin-converting enzyme (ACE) ligand (Kd = 2.79 nM). Exhibits no significant effect on ACE enzymatic activity up to 500 nM concentration. Potentiates NMDA + D-serine-induced dopamine release from striatal slices in vitro and the striatum in vivo.

H-Ile-Pro-Pro-OH, a milk-derived peptide, inhibits angiotensin-converting enzyme (ACE)[1] with an IC50 of 5 μM.

DX600 is a useful organic compound for research related to life sciences. The catalog number is T35324 and the CAS number is 478188-26-0.

N-Hippuryl-His-Leu (hydrate) is a synthetic substrate for angiotensin-converting enzyme (ACE) that has been used in the in vitro identification of ACE inhibitors.,

L-Isoleucyl-L-arginine, a dipeptide composed of L-isoleucine and L-arginine, acts as a potent angiotensin-converting enzyme (ACE) inhibitor and is utilized in hypertension research [1].

Ovalbumin (154-159), a peptide fragment derived from ovalbumin, acts as a potent inhibitor of the angiotensin-converting enzyme (ACE) and is utilized in hypertension research [1] [2].

Abz-Ser-Pro-3-nitro-Tyr is the substrate of ACE2 (angiotensin-converting enzyme-2) [1] .

N-Acetyl-Ser-Asp-Lys-Pro (Ac-SDKP) acetate, a specific substrate for the N-terminal active site of angiotensin-converting enzyme (ACE), functions as a natural inhibitor of pluripotent hematopoietic stem cell proliferation. Additionally, it exhibits anti-inflammatory and antifibrotic properties [1] [2].

Bradykinin (1-5) is a major stable metabolite of Bradykinin, formed by the proteolytic action of angiotensin-converting enzyme (ACE).The bradykinin (BK) fragment (1-5) (RPPGF) is among the most stable of naturally occurring metabolites. Bradykinin (1-5) m

N-Acetyl-Ser-Asp-Lys-Pro (TFA) is an endogenous tetrapeptide that is naturally produced in the bone marrow. It serves as a specific substrate for the N-terminal site of ACE, the enzyme responsible for angiotensin converting activity.

Ovotransferrin (328-332), with an IC50 of 20 μM, exhibits protective activity against hypertension by inhibiting the Angiotensin-Converting Enzyme (ACE) and also displays anti-Cholinesterase (ChE) activity, suggesting a potential role in the treatment of Alzheimer's disease [1] [2].

STIEEQAKTFLDKFNHEAEDLFYQSSLASWN, a peptide related to angiotensin-converting enzyme 2 (ACE2), is utilized in research to examine ACE2's function [1].

Lactalbumin B (50-53) Alpha [Lactorphin Alpha], bovine, is a peptide composed of 4 amino acids recognized for its blood pressure-lowering properties and functions as an angiotensin-converting enzyme (ACE) inhibitor. This compound is frequently utilized in high blood pressure research.

H-Ile-Pro-Pro-OH hydrochloride, a tripeptide derived from milk [1], functions as an inhibitor of the angiotensin-converting enzyme (ACE) [1], demonstrating an inhibitory concentration (IC 50) of 5 μM [2]. This compound is recognized for its antihypertensive properties [1].

Hippuryl-His-Leu-OH serves as a substrate to measure angiotensin I converting enzyme activity. Upon its cleavage, the resultant His-Leu moiety reacts with o-phthaldialdehyde or Fluorescamine, facilitating fluorescence detection [1] [2] [3].

H-Pro-Phe-OH, a dipeptide composed of proline and phenylalanine, functions both as a substrate for prolinase and in polypeptide synthesis. Phenylalanine, an aromatic amino acid within this compound, has the capability to inhibit the activity of Angiotensin-converting enzyme (ACE) [1] [2].

Spike Binding Peptide 1 (SBP1), representing amino acids 21-43 of angiotensin-converting enzyme 2 (ACE2), has been utilized in a novel approach involving lipid nanoparticles (LNPs) encapsulated with oseltamivir phosphate and conjugated to SBP1. This formulation aims to investigate the possibility of achieving a controlled, long-term in vivo release of oseltamivir phosphate. Furthermore, a 2% concentration of SBP1 immobilized on crosslinked networks composed of hydroxy acrylate and ethylxanthate ethyl acrylate has demonstrated enhanced in vitro efficiency in capturing the spike glycoprotein of severe acute respiratory coronavirus 2 (SARS-CoV-2), also referred to as the surface glycoprotein.

Angiotensin (1-7) (ASP-ARG-VAL-TYR-ILE-HIS-PRO) is a synthetic heptapeptide identical to endogenous angiotensin-(1-7) , inhibits purified canine ACE activity (IC50=0.65 μM) with vasodilator and antiproliferative activities.

Bradykinin Potentiator C, a potent inhibitor of angiotensin-converting enzyme (ACE) with an inhibitory concentration (IC 50) of 7.1 μM for rabbit lung ACE, is regarded as a prototype for functional peptides [1].

H-Tyr-Lys-OH, a dipeptide, serves as a biomarker for AJH-1 and exhibits strong binding affinity to angiotensin converting enzyme (ACE) [1].

Excellent angiotensin I-converting enzyme (ACE) substrate with a Km value of 4.0 μM and a kcat value of 210s-1.

H-Val-Pro-Pro-OH (TFA) is an inhibitor of angiotensin I converting enzyme (ACE) (IC50: 9 μM).H-Val-Pro-Pro-OH (TFA) is a milk-derived proline peptide derivative.

Spinorphin TFA acts as an inhibitor for multiple enkephalin-degrading enzymes, including aminopeptidase (aminopeptidase), dipeptidyl aminopeptidase III (dipeptidyl aminopeptidase III), angiotensin-converting enzyme (angiotensin-converting enzyme), and enkephalinase (enkephalinase). It exhibits an antinociceptive effect [1].

H-Tyr-Phe-OH (L-Tyrosyl-L-phenylalanine) can be used as the biomarker to distinguish benign thyroid nodules (BTN) from thyroid cancer (TC). H-Tyr-Phe-OH is an orally active Angiotensin-converting enzyme inhibitor with the 48% inhibiton rate at 50 μM. H-Tyr-Phe-OH shows xanthine oxidase inhibitory activity(uric acid lowering) that acts as regulator of IL-8 production in neutrophil-like cells [1] [2] [3] [4].

H-Phe-Arg-OH is a dipeptide containing phenylalanine and arginine. H-Phe-Arg-OH can be separated from Bradykinin through Angiotensin-converting enzyme (ACE). H-Phe-Arg-OH can be used for metabolic research [1] .

Angiotensin I/II (1-6) TFA is a chemical compound comprising amino acids 1-6. It is derived from the Angiotensin I/II peptide, which is formed by the cleavage of the precursor angiotensinogen by renin. The resulting Angiotensin I is then hydrolyzed by angiotensin-converting enzyme (ACE) to produce biologically active Angiotensin II. Angiotensin II has been extensively studied for its potential applications in the treatment of Hypertension, Renin Angiotensin System, and Idiopathic Membranous Nephropathy[1][2][3].

Angiotensin I (human, mouse, rat) is the precursor to the vasoconstrictor peptide angiotensin II, cleaved by the angiotensin-converting enzyme (ACE).Angiotensin is a peptide hormone that causes vasoconstriction and an increase in blood pressure. It is part of the renin–angiotensin system, which regulates blood pressure. Angiotensin also stimulates the release of aldosterone from the adrenal cortex to promote sodium retention by the kidneys.

H-Val-Pro-Pro-OH is an inhibitor of Angiotensin I converting enzyme (ACE)( IC50 : 9 μM).