L-Threonine derivative-1 is acetylsalicylic acid-L-threonine ester with potential analgesic activity.

Helioxanthin derivative 5-4-2 （Helioxanthin 5-4-2） is an analogue of helioxanthin that shows anti-HBV activity in vitro and can be used to study HBV.

3-arylisoquinolinamine derivative is a compound with antitumor activity.

Kobusine derivative-1, a variant of Kobusine, exhibits antiproliferative effects on cancer cells [1].

This peptide is a potent humanin (HN) derivative. It completely suppresses neuronal cell death by Alzheimer's disease-relevant insults.

Cyclosporin A-Derivative 1 (Free base) is a crystalline intermediate derived from the opening of cyclosporin A.

Benzylbenzofuran Derivative-1 (Compound 8), a benzylbenzofuran derivative, is isolatable from Silene conoidea [1].

Derivative 2 is A novel Derivative of Cyclosporin A.Cyclosporin A is an immunosuppressant that binds to cyclophilin and inhibits calcineurin.

cis-Clopidogrel-MP derivative, also known as Clopidogrel-MP-AM, is a 3’-methoxyacetophenone derivative of Clopidogrel active metabolite. This compound is an orally-active platelet inhibitor specifically targeting the P2Y12 receptor.

Hemiasterlin Derivative-1, a derivative of hemiasterlin, is utilized in the synthesis of Antibody-Drug Conjugates (ADC).

6PGD-IN-S3 (6PGD Inhibitor S3) is an inhibitor of 6-phosphogluconate dehydrogenase (6PGD).

DOTA derivatives are phenoxy derivatives of cyclic Tosamide;Direct nitrification;It is more convenient to add nitro group after removing the protection of lithium aluminium hydride.

Cyclosporin A-Derivative 3 is a derivative of Cyclosporin A with calcineurin inhibition [1] .

Oleanolic acid derivative 2 is an oleanolic acid derivative.

Betulinic acid derivative-1 demonstrates potent inhibition of osteoclast (OC) differentiation, achieving an IC50 value of 1.86 μM.

Carbazole derivative 1 is used to reduce androgen or oestrogen levels in mammals.

Diarylalkane derivative 1 is used for the research of pancreatitis.

Benzamide Derivative 1 Benzamide derivative with gastrokinetic activity.Benzamide Derivative 1 can be used in the study of gastrointestinal diseases.

Hydrocarbon chain derivative 1 has inhibitory activities against lipid synthesis.

FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.Exendin-4 peptide derivatives are structurally derived from Exendin-4 and may relates to dual GLP-1/glucagon receptor agonists.

OT antagonist 1 demethyl derivative is the demethyl derivative of OT antagonist 1. OT antagonist 1 is a selective Oxytocin antagonist (Ki of 50 nM. )

Indirubin Derivative E804 is an effective inhibitor of IGF1R, which has an IC50 value of 0.65.

Pyridazinediones-derivative-1 has potential in treating neurodegenerative disorders.

Heterocyclyl carbamate derivative 1, a heterocyclyl carbamate derivative, is used for the research of neurological diseases and inflammatory.

Exendin-4 peptide derivative acetate is an acetate salt of Exendin-4 peptide derivative.

Prasugrel Metabolite Derivative-13C-d3 is the 13C and deuterated compound of Prasugrel Metabolite Derivative.

Kobusine derivative-2, a kobusine derivative, exhibits antiproliferative activity against cancer cells, particularly by inducing the arrest of MDA-MB-231 cells in the sub-G1 phase, thus highlighting its potential anticancer activity.

Cyclosporin A-Derivative 1 is a crystalline intermediate derived from the opening of cyclosporin A.

Oleanolic acid derivative 1 is an oleanolic acid derivative.

Glycerol derivative 1 is a Glycerol derivative.

Exendin derivative 1 is a 39 amino acid peptide.

cis-Clopidogrel-MP-13C-d3 Derivative is the 13C and deuterated compound of cis-Clopidogrel-MP Derivative.

Chol-5-en-24-al-3β-ol is a steroid compound.

PSMA617-TCMC is a derivative of PSMA-617 with structure modification, in which the caroboxy groups in DOTA ring is replaced by TCMC macrocycle. PSMA-617 is a ligand used to make 177Lu-PSMA-617, which is a radioactive molecule to fight cancer.

Questiomycin A derivatives 18 TFA is A Questiomycin A derivative with antibacterial and anticancer activity and inhibition of the expression of the cell-protective ER chaperone protein GRP78.

Questiomycin A derivatives 12 is a Questiomycin A derivative.

Questiomycin A derivatives 20 is a Questiomycin A derivative.

Questiomycin A derivatives 14 is a Questiomycin A derivative.

Questiomycin A derivatives 13 is a Questiomycin A derivative.

Questiomycin A derivatives 22 is a useful organic compound for research related to life sciences. The catalog number is T67721 and the CAS number is 1807725-35-4.

Thiazolidinone-Derivatives-1 inhibits the secretion of gastric acid and can be used in research on the treatment of gastric and duodenal ulcers.

Questiomycin A derivatives 24 is a useful organic compound for research related to life sciences. The catalog number is T67723 and the CAS number is 21033-44-3.

Questiomycin A derivatives 21 is a useful organic compound for research related to life sciences. The catalog number is T67720 and the CAS number is 1807725-36-5.

Questiomycin A derivatives 27 is a useful organic compound for research related to life sciences and the catalog number is T72086.

TPT-172, also known as R33 (described in Mecozzi et al' s paper), is a thiophene thiourea derivative with molecule weight 172 in free base form. There is no formal name yet, we temporally call this molecule as TPT-172. Please also see similar products: TP

Dxd (OQM5SD32BQ) is a potent inhibitor of DNA topoisomerase I with an IC50 of 0.31 μM. It is used as a conjugated drug of HER2-targeting ADC.

15-PGDH-IN-2 (Compound 2) is an inhibitor of 15-PGDH with an IC50 value of 0.274 nM. This compound is useful for research into hair loss, bone formation, gastric ulcer healing, and dermal wound healing [1].

PTZ-256 is a phenothiazine derivative with chemical name: 3-(10H-phenothiazin-10-yl)propane-1-amine. PTZ-256 has molecule weight 256, therefore, we call it as PTZ-256.

Fluprostenol isopropyl ester, a potent agonist of the F-series prostaglandin receptor, serves as a prodrug utilized clinically as an ocular hypotensive agent for glaucoma treatment. An impurity, 13(R),14(R)-epoxy fluprostenol isopropyl ester, arises during its production, existing as a chiral enantiomer of the epoxide. The pharmacological properties of this specific enantiomer have yet to be thoroughly investigated.