Peptides

Peptides are short chains of between two and fifty amino acids, linked by peptide bonds. Chains of less than ten or fifteen amino acids are called oligopeptides, and include dipeptides, tripeptides, and tripeptides. A polypeptide is a longer, continuous, and unbranched peptide chain of up to fifty amino acids. Hence, peptides fall under the broad chemical classes of biological oligomers and polymers, alongside nuclei acids, oligosaccharides, polysaccharides, and others. Targetmol provides more than 1000 polypeptide products, including pharmaceutical peptides, active peptides, peptide hormones, amino acid derivatives, and label peptides for scientific research only. We ensure quality by performing comprehensive analytical testing for our peptides (HPLC and LC-MS), stability testing and activity testing. Quality inspection results can be provided for customers.

Cat. No.	Product name	CAS No.	Purity
TP1902	G-Protein antagonist peptide	143675-79-0	98%
TP1902	Substance P-related peptide that inhibits binding of G proteins to their receptors. Competitively and reversibly inhibits M2 muscarinic receptor activation of Gi...
TP1559L	Ziconotide Acetate (107452-89-1 free base)	914454-03-8	98%
TP1559L	Ziconotide is an analgesic agent and has been used to treat neuropathic and non-neuropathic pain. Ziconotide acts by binding to N-type calcium channels situated ...
TP2246	Endothelin-1 (1-15), amide, human	TP2246	98%
TP2246	Endothelin-1 is one of the there isoforms of endothelin (identified as ET-1, -2, -3) with varying regions of expression and binding to at least four known endoth...
TP1664	Proinsulin C-Peptide (55-89), human	11097-48-6	98%
TP1664	Human proinsulin, the single-chain peptide precursor of insulin, consists of the insulin A and B chains connected by the 31 amino acid C-peptide. Cleavage of pro...
TP1502	MAGE-A3 (195-203)	171066-85-6	98%
TP1502	This peptide MAGE-3-encoded HLA-A24 epitope is a high MHC binder.The identification of this MAGE-3/HLA-A24 peptide may as a result effectiveially offer the oppor...
T7380	Protease-Activated Receptor-4	245443-52-1	98%
T7380	Protease-Activated Receptor-4 is the proteinase-activated receptor-4 (PAR4) agonist, with Antiplatelet Therapy
TP1199	Urotensin I	83930-33-0	98%
TP1199	Urotensin I is, 41-aa neuropeptide, acts as an agonist of CRF receptor with pEC50s of 11.46, 9.36 and 9.85 for human CRF1, human CRF2 and rat CRF2α receptors in ...
TP1875	CDK2	255064-79-0	98%
TP1875	CDK2 is a member of the eukaryotic S/T protein kinase family and its function is to catalyze the phosphoryl transfer of ATP γ-phosphate to serine or threonine hy...
TP2218	α-Conotoxin EI	170663-33-9	98%
TP2218	Selective antagonist of neuromuscular nicotinic receptors α1β1γδ
TP1818	Neuropeptide Y(29-64)	303052-45-1	98%
TP1818	Neuropeptide Y(29-64) is a 36 amino acid peptide, a fragment of Neuropeptide Y.
TP1141	GLP-1(7-36), amide acetate	1119517-19-9	98%
TP1141	GLP-1(7-36) Acetate is a major intestinal hormone that stimulates glucose-induced insulin secretion from β cells.
TP1618	PACAP-38 (31-38), human, mouse, rat	138764-85-9	98%
TP1618	PACAP-38 (31-38), human, mouse, rat demonstrates potent, efficacious, and sustained stimulatory effects on sympathetic neuronal NPY and catecholamine production....
TP1934	L-R4W2	206350-79-0	98%
TP1934	Vanilloid TRPV1 (VR1) receptor antagonist peptide (IC50 ~ 0.1 μM); blocks Ca2+ currents in dorsal root ganglion neurons. Analgesic in vivo.
TP2036	DPDPE	88373-73-3	98%
TP2036	DPDPE is selective δ-opioid receptor agonist peptide. Inhibits electrically stimulated contraction of mouse vas deferens in vitro (EC50 = 5.2 nM), and is antinoc...
TP1656	VIR-165	TP1656	98%
TP1656	VIR-165 is a modified form of virus inhibitory peptide (VIRIP), which corresponds to residues 353 to 372 of C-proximal region of human alpha1-antitrypsin, the mo...
TP1751	ACTH (34-39)	69454-10-0	98%
TP1751	ACTH (34-39) is an adrenocorticotropic hormone fragment.
TP1924	ZIP	863987-12-6	98%
TP1924	Novel, cell-permeable inhibitor of protein kinase Mζ (PKMζ), a constitutively active, atypical PKC isozyme involved in LTP maintenance. Selectively blocks PKMζ-i...
TP1911	CALP3	261969-05-5	98%
TP1911	Cell-permeable calmodulin (CaM) agonist that binds to the EF-hand/Ca2+-binding site. Activates phosphodiesterase in the absence of Ca2+ and inhibits Ca2+-mediate...
TP1154	Exendin-4 peptide derivative acetate	TP1154	98%
TP1154	GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.
TP1202	Calcitonin Gene Related Peptide (CGRP) II, rat	99889-63-1	98%
TP1202	Calcitonin Gene Related Peptide II is a potent, long-lasting vasodilator; activation of CGRP receptors on pancreatic β-cells increases plasma levels of pancreati...